Homologs in group_3267

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_03570 EHELCC_03570 100.0 Morganella morganii S2 hdeA acid-activated periplasmic chaperone HdeA
NLDBIP_03570 NLDBIP_03570 100.0 Morganella morganii S4 hdeA acid-activated periplasmic chaperone HdeA
LHKJJB_09400 LHKJJB_09400 100.0 Morganella morganii S3 hdeA acid-activated periplasmic chaperone HdeA
HKOGLL_09575 HKOGLL_09575 100.0 Morganella morganii S5 hdeA acid-activated periplasmic chaperone HdeA

Distribution of the homologs in the orthogroup group_3267

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3267

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AET1 4.42e-23 89 50 0 71 3 hdeA Acid stress chaperone HdeA Shigella flexneri
P0AES9 4.42e-23 89 50 0 71 1 hdeA Acid stress chaperone HdeA Escherichia coli (strain K12)
P0AET0 4.42e-23 89 50 0 71 3 hdeA Acid stress chaperone HdeA Escherichia coli O157:H7
Q8FWV4 2.8e-21 84 44 0 96 3 hdeA Probable acid stress chaperone HdeA Brucella suis biovar 1 (strain 1330)
A5VU57 6.83e-21 83 48 0 87 3 hdeA Probable acid stress chaperone HdeA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A9WY36 7.13e-21 83 48 0 87 3 hdeA Probable acid stress chaperone HdeA Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8YBJ4 7.13e-21 83 48 0 87 3 hdeA Probable acid stress chaperone HdeA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9ME89 7.13e-21 83 48 0 87 3 hdeA Probable acid stress chaperone HdeA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q577F1 7.13e-21 83 48 0 87 3 hdeA Probable acid stress chaperone HdeA Brucella abortus biovar 1 (strain 9-941)
Q2YK18 7.13e-21 83 48 0 87 1 hdeA Probable acid stress chaperone HdeA Brucella abortus (strain 2308)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_07400
Feature type CDS
Gene hdeA
Product acid-activated periplasmic chaperone HdeA
Location 163395 - 163736 (strand: 1)
Length 342 (nucleotides) / 113 (amino acids)

Contig

Accession contig_7
Length 171383 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3267
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF06411 HdeA/HdeB family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19777 acid stress chaperone HdeA - -

Protein Sequence

MKKLIIVGAIVAAMTSAFAMAADSTGPKHDVTQKPVSQWTCDDFLSIDESFYPTAVGIAGIITGKNKVEDSTIDVQGIMTATPTIIESCKKDPKSSFLQRVEEFGKSYSQISG

Flanking regions ( +/- flanking 50bp)

AACTGCTAATCTGGTTATTGTATTATTACTGCTATACAAGTGAGGATATAATGAAAAAACTAATCATTGTTGGTGCAATTGTTGCTGCTATGACCAGTGCCTTCGCTATGGCTGCCGATAGTACCGGCCCGAAACACGATGTTACGCAAAAACCGGTATCACAATGGACCTGTGACGATTTTCTCTCTATTGATGAAAGTTTCTATCCGACAGCTGTCGGTATAGCCGGGATTATCACAGGTAAAAATAAGGTTGAAGATTCCACTATCGATGTTCAGGGGATTATGACCGCAACTCCGACAATTATTGAATCATGCAAAAAAGATCCAAAATCCTCTTTTTTACAAAGAGTTGAAGAATTTGGTAAATCATACTCACAAATATCCGGCTGATAACCCGGCAGTTCAGGTACTCTGAGGGAGCATTTGTCTCCCTCAATCCT