Homologs in group_2744

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_03590 EHELCC_03590 100.0 Morganella morganii S2 acyP Acylphosphatase
NLDBIP_03590 NLDBIP_03590 100.0 Morganella morganii S4 acyP Acylphosphatase
LHKJJB_09420 LHKJJB_09420 100.0 Morganella morganii S3 acyP Acylphosphatase
HKOGLL_09555 HKOGLL_09555 100.0 Morganella morganii S5 acyP Acylphosphatase
PMI_RS03895 PMI_RS03895 52.2 Proteus mirabilis HI4320 - acylphosphatase

Distribution of the homologs in the orthogroup group_2744

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2744

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N5Z2 3.62e-30 105 54 0 91 3 acyP Acylphosphatase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8FJ70 9.01e-21 81 49 1 83 3 yccX Acylphosphatase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1A9N7 1.39e-20 81 48 1 83 3 yccX Acylphosphatase Escherichia coli O1:K1 / APEC
P0AB65 1.81e-20 80 49 1 83 1 yccX Acylphosphatase Escherichia coli (strain K12)
P0AB66 1.81e-20 80 49 1 83 3 yccX Acylphosphatase Escherichia coli O157:H7
Q83LL9 2.38e-20 80 48 1 83 3 yccX Acylphosphatase Shigella flexneri
Q31YN1 2.38e-20 80 48 1 83 3 yccX Acylphosphatase Shigella boydii serotype 4 (strain Sb227)
Q7CQS9 8.14e-20 79 47 1 84 3 yccX Acylphosphatase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGT4 8.14e-20 79 47 1 84 3 yccX Acylphosphatase Salmonella typhi
A9MHS1 9.18e-20 79 46 1 84 3 yccX Acylphosphatase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q5PGB8 5.69e-19 77 46 1 84 3 yccX Acylphosphatase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A7ME43 1.08e-18 76 47 2 87 3 acyP Acylphosphatase Cronobacter sakazakii (strain ATCC BAA-894)
A1JMX0 2.01e-18 75 44 0 83 3 acyP Acylphosphatase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8AIA9 1.71e-17 73 44 2 86 3 acyP Acylphosphatase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q66CD9 2.39e-16 70 42 0 83 3 acyP Acylphosphatase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CGL9 2.39e-16 70 42 0 83 3 acyP Acylphosphatase Yersinia pestis bv. Antiqua (strain Nepal516)
A7FJR7 2.39e-16 70 42 0 83 3 acyP Acylphosphatase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4W8Y0 4.68e-16 69 45 1 84 3 acyP Acylphosphatase Enterobacter sp. (strain 638)
Q9CNN1 7.06e-16 69 45 2 90 3 acyP Acylphosphatase Pasteurella multocida (strain Pm70)
A6T769 1.2e-15 68 48 0 70 3 acyP Acylphosphatase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q6D6C4 1.92e-15 68 38 0 90 3 acyP Acylphosphatase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8GCM9 2.26e-15 68 39 0 83 3 acyP Acylphosphatase Serratia proteamaculans (strain 568)
A6VN24 1.78e-14 65 46 1 73 3 acyP Acylphosphatase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P84142 2.61e-14 65 49 1 69 1 acyP Acylphosphatase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8U414 2.91e-14 65 44 1 84 3 acyP Acylphosphatase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q38VU9 5.31e-14 64 41 0 78 3 acyP Acylphosphatase Latilactobacillus sakei subsp. sakei (strain 23K)
Q2NU62 1.49e-13 62 50 0 57 3 acyP Acylphosphatase Sodalis glossinidius (strain morsitans)
Q9UY47 2.57e-13 62 47 1 69 3 acyP Acylphosphatase Pyrococcus abyssi (strain GE5 / Orsay)
Q65MJ1 3.51e-13 62 51 1 66 3 acyP Acylphosphatase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A5GS00 6.33e-13 62 46 1 69 3 acyP Acylphosphatase Synechococcus sp. (strain RCC307)
Q6LQ38 8.56e-13 61 37 1 83 3 acyP Acylphosphatase Photobacterium profundum (strain SS9)
Q5L2Y4 9.86e-13 61 45 1 77 3 acyP Acylphosphatase Geobacillus kaustophilus (strain HTA426)
Q5JDG7 1.28e-12 60 46 1 69 3 acyP Acylphosphatase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q0K6H7 1.37e-12 60 44 1 74 3 acyP Acylphosphatase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q3M4K7 1.48e-12 61 49 1 69 3 acyP Acylphosphatase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q831U6 2.14e-12 60 41 2 86 3 acyP Acylphosphatase Enterococcus faecalis (strain ATCC 700802 / V583)
A5G1Y9 2.26e-12 60 44 1 75 3 acyP Acylphosphatase Acidiphilium cryptum (strain JF-5)
A7H8A3 2.32e-12 60 42 2 87 3 acyP Acylphosphatase Anaeromyxobacter sp. (strain Fw109-5)
Q8YYH3 2.55e-12 60 49 1 69 3 acyP Acylphosphatase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q1WUK1 2.89e-12 60 43 1 78 3 acyP Acylphosphatase Ligilactobacillus salivarius (strain UCC118)
Q46WU4 2.96e-12 60 45 1 73 3 acyP Acylphosphatase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q03G94 4.05e-12 59 37 0 86 3 acyP Acylphosphatase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q65UA8 4.33e-12 59 40 3 92 3 acyP Acylphosphatase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q5E4P9 5.5e-12 59 36 1 83 3 acyP Acylphosphatase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8G4T0 5.58e-12 59 47 1 70 3 acyP Acylphosphatase Bifidobacterium longum (strain NCC 2705)
Q482P4 6.05e-12 59 40 1 81 3 acyP Acylphosphatase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q0ABB1 7.19e-12 58 38 1 89 3 acyP Acylphosphatase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A1WDC8 9.6e-12 58 41 3 82 3 acyP Acylphosphatase Acidovorax sp. (strain JS42)
A6VA18 1.19e-11 58 41 1 90 3 acyP Acylphosphatase Pseudomonas aeruginosa (strain PA7)
Q60AX4 1.19e-11 58 44 2 81 3 acyP Acylphosphatase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1WUX3 1.25e-11 58 41 1 81 3 acyP Acylphosphatase Halorhodospira halophila (strain DSM 244 / SL1)
A9FGA8 1.29e-11 58 52 1 63 3 acyP Acylphosphatase Sorangium cellulosum (strain So ce56)
O35031 1.65e-11 58 46 1 71 1 acyP Acylphosphatase Bacillus subtilis (strain 168)
A3MYL5 2.07e-11 57 40 1 71 3 acyP Acylphosphatase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A1SWQ8 2.18e-11 57 41 1 85 3 acyP Acylphosphatase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q038C3 2.2e-11 57 38 1 88 3 acyP Acylphosphatase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q8Y2W3 2.46e-11 58 41 1 80 3 acyP1 Acylphosphatase 1 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A4IKB1 2.8e-11 57 44 1 77 3 acyP Acylphosphatase Geobacillus thermodenitrificans (strain NG80-2)
Q1LIH0 3.05e-11 57 47 1 65 3 acyP Acylphosphatase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q03VF5 3.41e-11 57 40 0 82 3 acyP Acylphosphatase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
A8F4E8 4.27e-11 57 45 2 68 3 acyP Acylphosphatase Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
A0AII3 7.57e-11 56 44 0 63 3 acyP Acylphosphatase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q7ML77 7.95e-11 56 37 1 83 3 acyP Acylphosphatase Vibrio vulnificus (strain YJ016)
Q8ELH4 8.23e-11 56 38 2 90 3 acyP Acylphosphatase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q2RQZ4 8.59e-11 56 45 1 70 3 acyP Acylphosphatase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q8D994 9.46e-11 56 37 1 83 3 acyP Acylphosphatase Vibrio vulnificus (strain CMCP6)
A3PXU3 1.01e-10 56 44 1 75 3 acyP Acylphosphatase Mycobacterium sp. (strain JLS)
A1VW83 1.02e-10 56 48 0 56 3 acyP Acylphosphatase Polaromonas naphthalenivorans (strain CJ2)
Q92BX4 1.06e-10 56 42 0 63 3 acyP Acylphosphatase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q1BAM3 1.08e-10 56 44 1 75 3 acyP Acylphosphatase Mycobacterium sp. (strain MCS)
A1UED9 1.08e-10 56 44 1 75 3 acyP Acylphosphatase Mycobacterium sp. (strain KMS)
Q8Y7A7 1.17e-10 55 42 0 63 3 acyP Acylphosphatase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71ZT9 1.17e-10 55 42 0 63 3 acyP Acylphosphatase Listeria monocytogenes serotype 4b (strain F2365)
A7Z2E2 1.23e-10 55 49 0 61 3 acyP Acylphosphatase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q3SRU5 1.23e-10 56 43 2 88 3 acyP Acylphosphatase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q3SKG9 1.25e-10 55 43 2 78 3 acyP Acylphosphatase Thiobacillus denitrificans (strain ATCC 25259)
Q9CHW2 1.66e-10 55 38 2 90 3 acyP Acylphosphatase Lactococcus lactis subsp. lactis (strain IL1403)
A5IM19 2.13e-10 55 45 2 81 3 acyP Acylphosphatase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9X1Q0 2.13e-10 55 45 2 81 3 acyP Acylphosphatase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A5D1R6 2.24e-10 55 42 1 76 3 acyP Acylphosphatase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q3AYW4 2.32e-10 55 42 2 75 3 acyP Acylphosphatase Synechococcus sp. (strain CC9902)
Q0IBG0 2.33e-10 55 41 1 77 3 acyP Acylphosphatase Synechococcus sp. (strain CC9311)
Q87P91 2.65e-10 55 33 1 83 3 acyP Acylphosphatase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8XU24 3.94e-10 54 43 2 83 3 acyP2 Acylphosphatase 2 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q4L6A9 4e-10 54 42 1 68 3 acyP Acylphosphatase Staphylococcus haemolyticus (strain JCSC1435)
Q3AIC0 4.18e-10 54 42 1 69 3 acyP Acylphosphatase Synechococcus sp. (strain CC9605)
Q1QLD8 4.23e-10 54 46 1 71 3 acyP Acylphosphatase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A1KAG5 5.72e-10 54 42 1 70 3 acyP Acylphosphatase Azoarcus sp. (strain BH72)
Q03RM5 5.98e-10 54 35 0 85 3 acyP Acylphosphatase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q9KSA4 7.85e-10 53 41 1 68 3 acyP Acylphosphatase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q3JCP6 8.72e-10 53 40 1 82 3 acyP Acylphosphatase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q7A0X1 9.21e-10 53 44 1 67 3 acyP Acylphosphatase Staphylococcus aureus (strain MW2)
Q6G9F7 9.21e-10 53 44 1 67 3 acyP Acylphosphatase Staphylococcus aureus (strain MSSA476)
Q6GH04 9.21e-10 53 44 1 67 3 acyP Acylphosphatase Staphylococcus aureus (strain MRSA252)
Q7A5P1 9.21e-10 53 44 1 67 3 acyP Acylphosphatase Staphylococcus aureus (strain N315)
Q99U83 9.21e-10 53 44 1 67 3 acyP Acylphosphatase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QGV5 9.21e-10 53 44 1 67 3 acyP Acylphosphatase Staphylococcus aureus (strain Newman)
Q5HG16 9.21e-10 53 44 1 67 3 acyP Acylphosphatase Staphylococcus aureus (strain COL)
Q2YY14 9.21e-10 53 44 1 67 3 acyP Acylphosphatase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FYM9 9.21e-10 53 44 1 67 1 acyP Acylphosphatase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH34 9.21e-10 53 44 1 67 3 acyP Acylphosphatase Staphylococcus aureus (strain USA300)
A7X283 9.21e-10 53 44 1 67 3 acyP Acylphosphatase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q1QWG7 9.63e-10 53 45 1 66 3 acyP Acylphosphatase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9I504 1.15e-09 53 40 1 89 3 acyP Acylphosphatase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q97FB0 1.45e-09 53 45 1 68 3 acyP Acylphosphatase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B0C8Q6 1.51e-09 53 39 1 66 3 acyP Acylphosphatase Acaryochloris marina (strain MBIC 11017)
Q6N510 1.74e-09 53 40 1 75 3 acyP Acylphosphatase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q13J37 1.92e-09 53 43 1 66 3 acyP Acylphosphatase Paraburkholderia xenovorans (strain LB400)
Q8EEW0 1.99e-09 52 46 0 56 3 acyP Acylphosphatase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q2INT8 2e-09 52 42 1 69 3 acyP Acylphosphatase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q2K7M8 2.25e-09 52 48 1 66 3 acyP Acylphosphatase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q0SRK7 2.55e-09 52 40 1 82 3 acyP Acylphosphatase Clostridium perfringens (strain SM101 / Type A)
Q8XIZ0 2.55e-09 52 40 1 82 3 acyP Acylphosphatase Clostridium perfringens (strain 13 / Type A)
Q0TNY8 2.55e-09 52 40 1 82 3 acyP Acylphosphatase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q2JNH2 2.59e-09 52 45 0 61 3 acyP Acylphosphatase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q3A2F4 3.21e-09 52 46 1 66 3 acyP Acylphosphatase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q2KTJ9 3.29e-09 52 39 1 66 3 acyP Acylphosphatase Bordetella avium (strain 197N)
Q83AB0 3.87e-09 52 36 1 85 1 acyP Acylphosphatase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q21FZ9 4.19e-09 52 43 1 71 3 acyP Acylphosphatase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q2SDN9 4.75e-09 52 42 1 66 3 acyP Acylphosphatase Hahella chejuensis (strain KCTC 2396)
Q47GU0 4.95e-09 52 37 1 79 3 acyP Acylphosphatase Dechloromonas aromatica (strain RCB)
A1TZV5 5.4e-09 51 39 3 93 3 acyP Acylphosphatase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q3IPI5 6.99e-09 51 37 1 89 3 acyP Acylphosphatase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q971Z4 7.37e-09 51 42 1 69 3 acyP Acylphosphatase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
A9KH12 7.81e-09 51 36 1 85 3 acyP Acylphosphatase Coxiella burnetii (strain Dugway 5J108-111)
P00821 9.59e-09 51 38 0 65 1 ACYP2 Acylphosphatase-2 Meleagris gallopavo
Q7W2L1 9.68e-09 51 40 1 69 3 acyP Acylphosphatase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WDK7 9.68e-09 51 40 1 69 3 acyP Acylphosphatase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A5F8G9 9.77e-09 51 39 1 68 1 acyP Acylphosphatase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q135C2 1.01e-08 51 42 1 71 3 acyP Acylphosphatase Rhodopseudomonas palustris (strain BisB5)
Q74ES0 1.02e-08 50 38 2 92 3 acyP Acylphosphatase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q7VJW4 1.03e-08 51 37 2 88 3 acyP Acylphosphatase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q5EBE1 1.05e-08 51 37 0 69 3 acyp2 Acylphosphatase-2 Xenopus tropicalis
P07031 1.15e-08 51 37 0 66 1 ACYP2 Acylphosphatase-2 Gallus gallus
Q39S27 1.2e-08 50 36 2 92 3 acyP Acylphosphatase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q9VF36 1.28e-08 50 42 0 66 1 Acyp2 Acylphosphatase-2 Drosophila melanogaster
A4SML6 1.32e-08 50 46 1 66 3 acyP Acylphosphatase Aeromonas salmonicida (strain A449)
Q8R961 1.34e-08 50 39 0 64 3 acyP Acylphosphatase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q74ID8 1.46e-08 50 46 0 63 3 acyP Acylphosphatase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8KG42 1.56e-08 50 39 1 69 3 acyP Acylphosphatase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P00820 1.74e-08 50 38 0 65 1 ACYP2 Acylphosphatase-2 Oryctolagus cuniculus
A0KKF3 1.79e-08 50 46 1 66 3 acyP Acylphosphatase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
P14620 1.81e-08 50 37 0 66 1 ACYP2 Acylphosphatase-2 Anas platyrhynchos
P35744 1.91e-08 50 38 0 65 1 ACYP2 Acylphosphatase-2 Cavia porcellus
A1R3U5 2.3e-08 50 43 0 60 3 acyP Acylphosphatase Paenarthrobacter aurescens (strain TC1)
Q211P4 2.35e-08 50 40 1 76 3 acyP Acylphosphatase Rhodopseudomonas palustris (strain BisB18)
Q97ZL0 2.5e-08 50 40 3 83 1 acyP Acylphosphatase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q2S0V7 2.64e-08 50 42 3 87 3 acyP Acylphosphatase Salinibacter ruber (strain DSM 13855 / M31)
A5GM25 2.7e-08 50 40 1 69 3 acyP Acylphosphatase Synechococcus sp. (strain WH7803)
Q1MFT8 2.82e-08 50 39 2 81 3 acyP Acylphosphatase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q9RVU3 2.97e-08 49 38 2 83 1 acyP Acylphosphatase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
P56375 3.56e-08 50 36 0 66 1 Acyp2 Acylphosphatase-2 Mus musculus
P14621 3.61e-08 49 36 0 65 1 ACYP2 Acylphosphatase-2 Homo sapiens
P00819 3.9e-08 49 36 0 65 1 ACYP2 Acylphosphatase-2 Sus scrofa
Q73PK2 3.94e-08 49 59 0 49 3 acyP Acylphosphatase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
P07033 4.07e-08 49 36 0 65 1 ACYP2 Acylphosphatase-2 Bos taurus
A5UQ40 4.54e-08 49 38 2 75 3 acyP Acylphosphatase Roseiflexus sp. (strain RS-1)
A4WHP6 5.81e-08 49 38 4 92 3 acyP Acylphosphatase Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321 / PZ6)
A0QV24 6.47e-08 48 42 1 68 3 acyP Acylphosphatase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
O29440 6.83e-08 48 42 1 69 3 acyP Acylphosphatase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q985C8 6.91e-08 48 40 2 84 3 acyP Acylphosphatase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A5VFP2 6.97e-08 48 44 0 65 3 acyP Acylphosphatase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q8ZXK6 6.98e-08 48 39 3 84 3 acyP Acylphosphatase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q2FNJ0 7.78e-08 48 52 0 50 3 acyP Acylphosphatase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
A8I5S8 7.78e-08 48 43 2 71 3 acyP Acylphosphatase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A1VEL6 8.19e-08 48 43 0 60 3 acyP Acylphosphatase Nitratidesulfovibrio vulgaris (strain DP4)
Q72CU1 8.19e-08 48 43 0 60 3 acyP Acylphosphatase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A1T739 8.76e-08 48 39 1 74 3 acyP Acylphosphatase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q18K02 1.03e-07 48 35 1 85 3 acyP Acylphosphatase Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q1D0P6 1.05e-07 48 42 1 69 3 acyP Acylphosphatase Myxococcus xanthus (strain DK1622)
A6M163 1.1e-07 48 42 1 66 3 acyP Acylphosphatase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A1S579 1.11e-07 48 40 0 61 3 acyP Acylphosphatase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q5X427 1.15e-07 48 42 1 63 3 acyP Acylphosphatase Legionella pneumophila (strain Paris)
A5ID38 1.21e-07 48 42 1 63 3 acyP Acylphosphatase Legionella pneumophila (strain Corby)
A3MU96 1.24e-07 48 38 2 78 3 acyP Acylphosphatase Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
Q5WVG7 1.32e-07 48 42 1 63 3 acyP Acylphosphatase Legionella pneumophila (strain Lens)
Q5ZUC1 1.33e-07 48 42 1 63 3 acyP Acylphosphatase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q6L2I0 1.34e-07 47 35 0 57 3 acyP Acylphosphatase Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q07L15 1.36e-07 48 42 1 70 3 acyP Acylphosphatase Rhodopseudomonas palustris (strain BisA53)
P35745 1.82e-07 47 35 0 65 1 Acyp2 Acylphosphatase-2 Rattus norvegicus
Q30YK6 2.55e-07 47 43 0 58 3 acyP Acylphosphatase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
P00818 2.65e-07 47 35 0 65 1 ACYP2 Acylphosphatase-2 Equus caballus
Q041W5 2.75e-07 47 47 0 55 3 acyP Acylphosphatase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q1IKJ2 2.75e-07 47 40 1 70 3 acyP Acylphosphatase Koribacter versatilis (strain Ellin345)
Q4J8X9 2.99e-07 47 39 1 76 3 acyP Acylphosphatase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q89JL8 3.08e-07 47 37 1 80 3 acyP Acylphosphatase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P07032 3.54e-07 47 34 1 81 1 ACYP1 Acylphosphatase-1 Gallus gallus
A9BHQ1 3.68e-07 47 42 1 64 3 acyP Acylphosphatase Petrotoga mobilis (strain DSM 10674 / SJ95)
A0JTE5 4.37e-07 47 43 0 60 3 acyP Acylphosphatase Arthrobacter sp. (strain FB24)
Q6DE05 4.63e-07 47 33 0 72 3 acyp1 Acylphosphatase-1 Xenopus laevis
A5GA97 4.97e-07 46 40 1 74 3 acyP Acylphosphatase Geotalea uraniireducens (strain Rf4)
Q47S76 6.23e-07 46 37 1 74 3 acyP Acylphosphatase Thermobifida fusca (strain YX)
A1SPV1 7.59e-07 46 40 0 64 3 acyP Acylphosphatase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q5GWQ4 8.26e-07 45 44 2 79 3 acyP Acylphosphatase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NZV7 8.26e-07 45 44 2 79 3 acyP Acylphosphatase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
P24540 8.61e-07 46 28 1 92 1 ACYP1 Acylphosphatase-1 Sus scrofa
Q1J123 1.01e-06 45 40 1 66 3 acyP Acylphosphatase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q7NE87 1.08e-06 45 40 1 69 3 acyP Acylphosphatase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q2RJ59 1.13e-06 45 37 1 85 3 acyP Acylphosphatase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q28FK7 1.13e-06 45 34 0 70 3 acyp1 Acylphosphatase-1 Xenopus tropicalis
Q97CT1 1.28e-06 45 31 2 92 3 acyP Acylphosphatase Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q88WR7 1.28e-06 45 57 0 42 3 acyP Acylphosphatase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A4YHE5 1.3e-06 45 37 1 77 3 acyP Acylphosphatase Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
Q92TK9 1.6e-06 45 42 2 68 3 acyP Acylphosphatase Rhizobium meliloti (strain 1021)
A0B571 1.63e-06 45 37 1 74 3 acyP Acylphosphatase Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
P41500 1.67e-06 45 27 1 92 1 ACYP1 Acylphosphatase-1 Bos taurus
Q0S2D6 1.95e-06 45 37 1 72 3 acyP Acylphosphatase Rhodococcus jostii (strain RHA1)
Q5V2Y4 2.42e-06 45 40 1 85 3 acyP Acylphosphatase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q3BX12 2.42e-06 44 43 2 79 3 acyP Acylphosphatase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q0VPA8 2.55e-06 44 39 1 71 3 acyP Acylphosphatase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q5YS19 2.75e-06 45 41 0 60 3 acyP Acylphosphatase Nocardia farcinica (strain IFM 10152)
A6UH73 3.09e-06 44 41 2 68 3 acyP Acylphosphatase Sinorhizobium medicae (strain WSM419)
A1RU25 3.36e-06 44 40 2 66 3 acyP Acylphosphatase Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3)
Q1AXW6 3.73e-06 44 43 1 62 3 acyP Acylphosphatase Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
P07311 3.92e-06 44 27 1 92 1 ACYP1 Acylphosphatase-1 Homo sapiens
A0LI66 5.98e-06 43 36 1 77 3 acyP Acylphosphatase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A8FAY5 6.24e-06 43 40 2 70 3 acyP Acylphosphatase Bacillus pumilus (strain SAFR-032)
Q8EZ81 7.12e-06 43 34 1 69 3 acyP Acylphosphatase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72ML5 7.12e-06 43 34 1 69 3 acyP Acylphosphatase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q6ASQ0 7.87e-06 43 33 2 78 3 acyP Acylphosphatase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q8PC73 9.61e-06 43 43 1 73 3 acyP Acylphosphatase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URB1 9.61e-06 43 43 1 73 3 acyP Acylphosphatase Xanthomonas campestris pv. campestris (strain 8004)
A9WAI7 1.15e-05 43 37 1 69 3 acyP Acylphosphatase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A1RZ22 1.82e-05 42 37 1 77 3 acyP Acylphosphatase Thermofilum pendens (strain DSM 2475 / Hrk 5)
Q3ZXY7 1.96e-05 42 35 4 88 3 acyP Acylphosphatase Dehalococcoides mccartyi (strain CBDB1)
P56376 2.32e-05 42 27 1 88 1 Acyp1 Acylphosphatase-1 Mus musculus
P56544 2.56e-05 42 32 0 68 1 Acyp Acylphosphatase-1 Drosophila melanogaster
Q0BUL9 3.22e-05 42 37 1 70 3 acyP Acylphosphatase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
A5FQM9 3.25e-05 42 40 2 67 3 acyP Acylphosphatase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q82JU5 3.45e-05 42 38 2 73 3 acyP Acylphosphatase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
O50977 4.11e-05 41 30 1 78 3 acyP Acylphosphatase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q21YG7 4.11e-05 41 34 1 75 3 acyP Acylphosphatase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q9ZBQ3 4.86e-05 41 39 2 73 3 acyP Acylphosphatase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q0SL54 6.7e-05 41 31 0 76 3 acyP Acylphosphatase Borreliella afzelii (strain PKo)
A7HMJ7 8.89e-05 40 36 1 79 3 acyP Acylphosphatase Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Q01Q91 9.16e-05 40 36 1 86 3 acyP Acylphosphatase Solibacter usitatus (strain Ellin6076)
P9WQC9 0.000112 40 35 1 68 1 acyP Acylphosphatase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQC8 0.000112 40 35 1 68 3 acyP Acylphosphatase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U6S8 0.000112 40 35 1 68 3 acyP Acylphosphatase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KMR7 0.000112 40 35 1 68 3 acyP Acylphosphatase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P69418 0.000112 40 35 1 68 3 acyP Acylphosphatase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q3Z7Q6 0.000112 40 38 2 67 3 acyP Acylphosphatase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
A8MC09 0.000125 40 42 2 71 3 acyP Acylphosphatase Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167)
A4JK94 0.000209 40 43 1 60 3 acyP Acylphosphatase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0B602 0.000223 40 43 1 60 3 acyP Acylphosphatase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q2LTM9 0.000255 39 40 0 59 3 acyP Acylphosphatase Syntrophus aciditrophicus (strain SB)
O07451 0.000414 40 40 1 64 3 hypF2 Carbamoyltransferase HypF2 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q9YBK7 0.00043 39 38 2 70 3 acyP Acylphosphatase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q39BD4 0.000436 39 41 1 60 3 acyP Acylphosphatase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q63IA7 0.000666 38 43 1 60 3 acyP Acylphosphatase Burkholderia pseudomallei (strain K96243)
A3NNW7 0.000666 38 43 1 60 3 acyP Acylphosphatase Burkholderia pseudomallei (strain 668)
Q3JJ17 0.000666 38 43 1 60 3 acyP Acylphosphatase Burkholderia pseudomallei (strain 1710b)
Q1BJL9 0.000666 38 41 1 60 3 acyP Acylphosphatase Burkholderia orbicola (strain AU 1054)
Q62A02 0.000666 38 43 1 60 3 acyP Acylphosphatase Burkholderia mallei (strain ATCC 23344)
A3MGM0 0.000666 38 43 1 60 3 acyP Acylphosphatase Burkholderia mallei (strain NCTC 10247)
A0B3Q5 0.000666 38 41 1 60 3 acyP Acylphosphatase Burkholderia cenocepacia (strain HI2424)
Q2J6Z2 0.000695 38 38 0 60 3 acyP Acylphosphatase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q73VM2 0.000872 38 39 0 56 3 acyP Acylphosphatase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QJ63 0.000872 38 39 0 56 3 acyP Acylphosphatase Mycobacterium avium (strain 104)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_07380
Feature type CDS
Gene acyP
Product Acylphosphatase
Location 161014 - 161292 (strand: 1)
Length 279 (nucleotides) / 92 (amino acids)
In genomic island -

Contig

Accession contig_7
Length 171383 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2744
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00708 Acylphosphatase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1254 Energy production and conversion (C) C Acylphosphatase

Kegg Ortholog Annotation(s)

Protein Sequence

MKIGRHFAVYGRVQGVGFRYQTFYWAKRHNVTGFVRNRQDGSVEIEAYGDESVLEAMTAWLEAGGPPGAKVTDIIATPCDYREVAVFRVRHE

Flanking regions ( +/- flanking 50bp)

ACAGCGATACAGATTAAAATAGTGACATTTTCGGAAAAAGGAGCGACATAATGAAGATCGGACGACATTTTGCCGTATACGGACGCGTTCAGGGCGTTGGTTTCCGCTATCAAACGTTTTACTGGGCAAAACGCCATAATGTGACCGGTTTTGTCCGCAATCGTCAGGATGGCAGTGTGGAAATTGAAGCGTATGGCGATGAAAGTGTGCTGGAGGCGATGACTGCATGGCTGGAGGCGGGCGGGCCGCCGGGGGCGAAAGTGACAGATATCATCGCAACCCCCTGTGATTACAGGGAAGTTGCGGTATTCCGTGTCCGCCACGAATAAACGGCGGTCAGATACATTTCACCGGTTTCGGCAGACCGGCCAGCTTTGTT