Homologs in group_1194

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_09505 EHELCC_09505 100.0 Morganella morganii S2 rpsT 30S ribosomal protein S20
NLDBIP_09885 NLDBIP_09885 100.0 Morganella morganii S4 rpsT 30S ribosomal protein S20
LHKJJB_07870 LHKJJB_07870 100.0 Morganella morganii S3 rpsT 30S ribosomal protein S20
HKOGLL_07420 HKOGLL_07420 100.0 Morganella morganii S5 rpsT 30S ribosomal protein S20
F4V73_RS15465 F4V73_RS15465 96.5 Morganella psychrotolerans rpsT 30S ribosomal protein S20
PMI_RS00065 PMI_RS00065 88.4 Proteus mirabilis HI4320 rpsT 30S ribosomal protein S20

Distribution of the homologs in the orthogroup group_1194

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1194

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F2T3 4.06e-50 155 88 0 86 3 rpsT Small ribosomal subunit protein bS20 Proteus mirabilis (strain HI4320)
Q7N8X4 6.08e-50 155 89 0 86 3 rpsT Small ribosomal subunit protein bS20 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2NVY8 4.85e-49 152 87 0 86 3 rpsT Small ribosomal subunit protein bS20 Sodalis glossinidius (strain morsitans)
B1JL00 2.6e-48 150 86 0 86 3 rpsT Small ribosomal subunit protein bS20 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66ES6 2.6e-48 150 86 0 86 3 rpsT Small ribosomal subunit protein bS20 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQF5 2.6e-48 150 86 0 86 3 rpsT Small ribosomal subunit protein bS20 Yersinia pestis (strain Pestoides F)
Q1CMV3 2.6e-48 150 86 0 86 3 rpsT Small ribosomal subunit protein bS20 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R010 2.6e-48 150 86 0 86 3 rpsT Small ribosomal subunit protein bS20 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIM3 2.6e-48 150 86 0 86 3 rpsT Small ribosomal subunit protein bS20 Yersinia pestis
B2K3M4 2.6e-48 150 86 0 86 3 rpsT Small ribosomal subunit protein bS20 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0J5 2.6e-48 150 86 0 86 3 rpsT Small ribosomal subunit protein bS20 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMD9 2.6e-48 150 86 0 86 3 rpsT Small ribosomal subunit protein bS20 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JJD9 5.13e-48 150 84 0 86 3 rpsT Small ribosomal subunit protein bS20 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VGR4 5.6e-48 150 87 0 86 3 rpsT Small ribosomal subunit protein bS20 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6DF06 1.46e-47 149 84 0 86 3 rpsT Small ribosomal subunit protein bS20 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C4K3I3 4.86e-47 148 83 0 86 3 rpsT Small ribosomal subunit protein bS20 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q6D0C1 9.84e-47 146 83 0 86 3 rpsT Small ribosomal subunit protein bS20 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4W6D9 1.67e-46 146 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Enterobacter sp. (strain 638)
Q3Z5Y7 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Shigella sonnei (strain Ss046)
Q32K74 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Shigella dysenteriae serotype 1 (strain Sd197)
Q326K0 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Shigella boydii serotype 4 (strain Sb227)
B2U242 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LVQ1 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RGH9 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli (strain UTI89 / UPEC)
B1LFV4 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli (strain SMS-3-5 / SECEC)
B6HZ18 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli (strain SE11)
B7N7P7 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7U7 1.6e-45 144 87 0 83 1 rpsT Small ribosomal subunit protein bS20 Escherichia coli (strain K12)
B1IRF1 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7U8 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLW7 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZVX1 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli O9:H4 (strain HS)
B1XBE8 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli (strain K12 / DH10B)
C4ZPU9 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0B9 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli O8 (strain IAI1)
B7MNM8 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli O81 (strain ED1a)
B7NHC8 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YYB6 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7U9 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli O157:H7
B7L4E5 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli (strain 55989 / EAEC)
B7MAE3 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UI68 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHB2 1.6e-45 144 87 0 83 3 rpsT Small ribosomal subunit protein bS20 Escherichia coli O139:H28 (strain E24377A / ETEC)
B5Y237 2.22e-45 143 86 0 83 3 rpsT Small ribosomal subunit protein bS20 Klebsiella pneumoniae (strain 342)
P0A2B1 3.2e-44 140 85 0 83 3 rpsT Small ribosomal subunit protein bS20 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2B2 3.2e-44 140 85 0 83 3 rpsT Small ribosomal subunit protein bS20 Salmonella typhi
B4TWN4 3.2e-44 140 85 0 83 3 rpsT Small ribosomal subunit protein bS20 Salmonella schwarzengrund (strain CVM19633)
B5BLK7 3.2e-44 140 85 0 83 3 rpsT Small ribosomal subunit protein bS20 Salmonella paratyphi A (strain AKU_12601)
C0Q4I2 3.2e-44 140 85 0 83 3 rpsT Small ribosomal subunit protein bS20 Salmonella paratyphi C (strain RKS4594)
Q5PDM2 3.2e-44 140 85 0 83 3 rpsT Small ribosomal subunit protein bS20 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T6G9 3.2e-44 140 85 0 83 3 rpsT Small ribosomal subunit protein bS20 Salmonella newport (strain SL254)
B4TIE3 3.2e-44 140 85 0 83 3 rpsT Small ribosomal subunit protein bS20 Salmonella heidelberg (strain SL476)
B5R0X8 3.2e-44 140 85 0 83 3 rpsT Small ribosomal subunit protein bS20 Salmonella enteritidis PT4 (strain P125109)
B5FHD7 3.2e-44 140 85 0 83 3 rpsT Small ribosomal subunit protein bS20 Salmonella dublin (strain CT_02021853)
Q57TL8 3.2e-44 140 85 0 83 3 rpsT Small ribosomal subunit protein bS20 Salmonella choleraesuis (strain SC-B67)
A9MR48 3.2e-44 140 85 0 83 3 rpsT Small ribosomal subunit protein bS20 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F721 3.2e-44 140 85 0 83 3 rpsT Small ribosomal subunit protein bS20 Salmonella agona (strain SL483)
B5RF40 1.21e-43 139 84 0 83 3 rpsT Small ribosomal subunit protein bS20 Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q0T8H0 1.32e-42 136 85 0 83 3 rpsT Small ribosomal subunit protein bS20 Shigella flexneri serotype 5b (strain 8401)
Q9CKG0 5.36e-41 132 76 0 86 3 rpsT Small ribosomal subunit protein bS20 Pasteurella multocida (strain Pm70)
P42275 6.99e-41 131 87 0 71 3 rpsT Small ribosomal subunit protein bS20 (Fragment) Proteus mirabilis
A8G9L2 1.01e-40 131 77 0 86 3 rpsT Small ribosomal subunit protein bS20 Serratia proteamaculans (strain 568)
Q7VKC6 1.38e-40 131 76 0 86 3 rpsT Small ribosomal subunit protein bS20 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q6LUL5 3.13e-40 130 77 0 86 3 rpsT Small ribosomal subunit protein bS20 Photobacterium profundum (strain SS9)
A6VR57 5.17e-40 129 75 0 86 3 rpsT Small ribosomal subunit protein bS20 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0USI0 1.22e-39 129 75 0 86 3 rpsT Small ribosomal subunit protein bS20 Histophilus somni (strain 2336)
Q0I2D7 1.22e-39 129 75 0 86 3 rpsT Small ribosomal subunit protein bS20 Histophilus somni (strain 129Pt)
B8F6H9 2.02e-39 128 74 0 86 3 rpsT Small ribosomal subunit protein bS20 Glaesserella parasuis serovar 5 (strain SH0165)
Q4QLU2 2.94e-39 128 73 0 86 3 rpsT Small ribosomal subunit protein bS20 Haemophilus influenzae (strain 86-028NP)
P44959 4.25e-39 127 74 0 86 3 rpsT Small ribosomal subunit protein bS20 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UDA4 4.25e-39 127 74 0 86 3 rpsT Small ribosomal subunit protein bS20 Haemophilus influenzae (strain PittEE)
Q3IEA5 5.8e-39 127 74 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudoalteromonas translucida (strain TAC 125)
Q83SR1 1.07e-38 126 81 0 83 3 rpsT Small ribosomal subunit protein bS20 Shigella flexneri
Q1LST1 1.85e-38 125 73 0 86 3 rpsT Small ribosomal subunit protein bS20 Baumannia cicadellinicola subsp. Homalodisca coagulata
A4SIX2 2.78e-38 125 79 0 86 3 rpsT Small ribosomal subunit protein bS20 Aeromonas salmonicida (strain A449)
A0KG36 6.18e-38 124 77 0 86 3 rpsT Small ribosomal subunit protein bS20 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A3QBW9 9.35e-38 124 74 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q0HS79 2.32e-37 123 74 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella sp. (strain MR-7)
Q0HFY6 2.32e-37 123 74 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella sp. (strain MR-4)
A0KZZ5 2.32e-37 123 74 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella sp. (strain ANA-3)
Q8EBH9 3.12e-37 122 74 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P45601 5.73e-37 121 84 0 71 3 rpsT Small ribosomal subunit protein bS20 (Fragment) Klebsiella pneumoniae
Q15R01 2.31e-36 120 75 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B7VJ84 2.53e-36 120 72 0 86 3 rpsT Small ribosomal subunit protein bS20 Vibrio atlanticus (strain LGP32)
A8FSH9 2.74e-36 120 72 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella sediminis (strain HAW-EB3)
A1S422 3.98e-36 120 73 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B8CSC5 4.44e-36 120 72 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella piezotolerans (strain WP3 / JCM 13877)
A1RMM9 5.84e-36 119 73 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella sp. (strain W3-18-1)
A4Y4A1 5.84e-36 119 73 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9L4U3 1.06e-35 119 73 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella baltica (strain OS195)
A6WKD1 1.06e-35 119 73 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella baltica (strain OS185)
A3D1G2 1.06e-35 119 73 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EFD0 1.06e-35 119 73 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella baltica (strain OS223)
Q07Z32 3.85e-35 117 70 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella frigidimarina (strain NCIMB 400)
Q7MNN1 4.15e-35 117 75 0 86 3 rpsT Small ribosomal subunit protein bS20 Vibrio vulnificus (strain YJ016)
Q8DES4 4.15e-35 117 75 0 86 3 rpsT Small ribosomal subunit protein bS20 Vibrio vulnificus (strain CMCP6)
Q5QZS3 8.01e-35 116 68 0 86 3 rpsT Small ribosomal subunit protein bS20 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q87S93 9.66e-35 116 74 0 86 3 rpsT Small ribosomal subunit protein bS20 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C4LD15 1.13e-34 116 76 0 86 3 rpsT Small ribosomal subunit protein bS20 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B8D756 1.73e-34 115 64 0 84 3 rpsT Small ribosomal subunit protein bS20 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57251 1.73e-34 115 64 0 84 3 rpsT Small ribosomal subunit protein bS20 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8V2 1.73e-34 115 64 0 84 3 rpsT Small ribosomal subunit protein bS20 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B0BRF3 3.96e-34 115 79 0 86 3 rpsT Small ribosomal subunit protein bS20 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GYP1 3.96e-34 115 79 0 86 3 rpsT Small ribosomal subunit protein bS20 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N2K6 3.96e-34 115 79 0 86 3 rpsT Small ribosomal subunit protein bS20 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B1KIT2 6.32e-33 112 73 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella woodyi (strain ATCC 51908 / MS32)
Q12KM1 6.53e-33 112 72 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B6EMY3 6.66e-33 112 70 0 86 3 rpsT Small ribosomal subunit protein bS20 Aliivibrio salmonicida (strain LFI1238)
Q486U3 1.09e-32 111 68 0 86 3 rpsT Small ribosomal subunit protein bS20 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A8H1H0 2.11e-32 110 70 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TJA6 2.11e-32 110 70 0 86 3 rpsT Small ribosomal subunit protein bS20 Shewanella halifaxensis (strain HAW-EB4)
C3LST4 3.81e-32 110 72 0 86 3 rpsT Small ribosomal subunit protein bS20 Vibrio cholerae serotype O1 (strain M66-2)
O34239 3.81e-32 110 72 0 86 3 rpsT Small ribosomal subunit protein bS20 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F8Z0 3.81e-32 110 72 0 86 3 rpsT Small ribosomal subunit protein bS20 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A1SZP6 9.99e-32 108 63 0 86 3 rpsT Small ribosomal subunit protein bS20 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q8K9Z0 2.79e-31 107 63 0 83 3 rpsT Small ribosomal subunit protein bS20 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q0BP66 3.35e-31 107 61 0 86 3 rpsT Small ribosomal subunit protein bS20 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5X7 3.35e-31 107 61 0 86 3 rpsT Small ribosomal subunit protein bS20 Francisella tularensis subsp. holarctica (strain LVS)
A7N9A3 3.35e-31 107 61 0 86 3 rpsT Small ribosomal subunit protein bS20 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A4J079 1.08e-30 106 61 0 86 3 rpsT Small ribosomal subunit protein bS20 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NEF7 1.08e-30 106 61 0 86 3 rpsT Small ribosomal subunit protein bS20 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q452 1.08e-30 106 61 0 86 3 rpsT Small ribosomal subunit protein bS20 Francisella tularensis subsp. novicida (strain U112)
B2SEJ5 1.08e-30 106 61 0 86 3 rpsT Small ribosomal subunit protein bS20 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14FW0 1.08e-30 106 61 0 86 3 rpsT Small ribosomal subunit protein bS20 Francisella tularensis subsp. tularensis (strain FSC 198)
B0TW34 1.87e-30 105 61 0 86 3 rpsT Small ribosomal subunit protein bS20 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q65RP7 7.57e-30 104 73 0 86 3 rpsT Small ribosomal subunit protein bS20 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B5FA57 8.66e-30 103 70 0 86 3 rpsT Small ribosomal subunit protein bS20 Aliivibrio fischeri (strain MJ11)
Q9HVM1 1.01e-29 103 65 0 86 1 rpsT Small ribosomal subunit protein bS20 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02GB4 1.01e-29 103 65 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V0A6 1.01e-29 103 65 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudomonas aeruginosa (strain LESB58)
A4XQV2 2.16e-29 103 65 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudomonas mendocina (strain ymp)
Q8D2Q8 6.96e-29 101 54 0 86 3 rpsT Small ribosomal subunit protein bS20 Wigglesworthia glossinidia brevipalpis
P45787 7.23e-29 101 75 0 72 3 rpsT Small ribosomal subunit protein bS20 (Fragment) Aeromonas salmonicida
P45788 1.49e-28 100 73 0 72 3 rpsT Small ribosomal subunit protein bS20 (Fragment) Aeromonas sobria
P45786 1.49e-28 100 73 0 72 3 rpsT Small ribosomal subunit protein bS20 (Fragment) Aeromonas hydrophila
Q5WTG3 2.18e-28 100 62 0 86 3 rpsT Small ribosomal subunit protein bS20 Legionella pneumophila (strain Lens)
Q5ZS83 2.18e-28 100 62 0 86 3 rpsT Small ribosomal subunit protein bS20 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IAU0 2.18e-28 100 62 0 86 3 rpsT Small ribosomal subunit protein bS20 Legionella pneumophila (strain Corby)
Q5X1Q4 2.18e-28 100 62 0 86 3 rpsT Small ribosomal subunit protein bS20 Legionella pneumophila (strain Paris)
Q0AAD4 3.64e-28 100 64 0 79 3 rpsT Small ribosomal subunit protein bS20 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A4VI57 4.35e-28 100 62 0 86 3 rpsT Small ribosomal subunit protein bS20 Stutzerimonas stutzeri (strain A1501)
Q4ZYJ7 6.18e-28 99 63 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudomonas syringae pv. syringae (strain B728a)
Q889E8 6.18e-28 99 63 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48NK9 6.18e-28 99 63 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
C1DE99 7.65e-28 99 62 0 86 3 rpsT Small ribosomal subunit protein bS20 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B1JF86 7.87e-28 99 63 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudomonas putida (strain W619)
Q88Q95 7.87e-28 99 63 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KM81 7.87e-28 99 63 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudomonas putida (strain GB-1)
A5VY49 7.87e-28 99 63 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1I4S2 7.87e-28 99 63 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudomonas entomophila (strain L48)
Q493S5 1.07e-27 99 60 0 86 3 rpsT Small ribosomal subunit protein bS20 Blochmanniella pennsylvanica (strain BPEN)
C3KDX1 1.39e-27 98 62 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudomonas fluorescens (strain SBW25)
Q4K5U1 1.89e-27 98 63 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q21M04 1.97e-27 98 62 0 86 3 rpsT Small ribosomal subunit protein bS20 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q3K6L2 2.3e-27 98 62 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudomonas fluorescens (strain Pf0-1)
Q6FCF6 8.98e-27 96 60 0 86 3 rpsT Small ribosomal subunit protein bS20 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0VD42 1.11e-26 96 59 0 86 3 rpsT Small ribosomal subunit protein bS20 Acinetobacter baumannii (strain AYE)
A3M550 1.11e-26 96 59 0 86 3 rpsT Small ribosomal subunit protein bS20 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VNU2 1.11e-26 96 59 0 86 3 rpsT Small ribosomal subunit protein bS20 Acinetobacter baumannii (strain SDF)
B2HZH0 1.11e-26 96 59 0 86 3 rpsT Small ribosomal subunit protein bS20 Acinetobacter baumannii (strain ACICU)
B7I5N9 1.11e-26 96 59 0 86 1 rpsT Small ribosomal subunit protein bS20 Acinetobacter baumannii (strain AB0057)
B7H3I4 1.11e-26 96 59 0 86 3 rpsT Small ribosomal subunit protein bS20 Acinetobacter baumannii (strain AB307-0294)
Q0VSE4 5.04e-26 94 58 0 86 3 rpsT Small ribosomal subunit protein bS20 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A5WE06 6.56e-26 94 59 0 86 3 rpsT Small ribosomal subunit protein bS20 Psychrobacter sp. (strain PRwf-1)
C5BQB7 8.07e-26 94 63 0 86 3 rpsT Small ribosomal subunit protein bS20 Teredinibacter turnerae (strain ATCC 39867 / T7901)
A6VBV0 1.22e-25 93 63 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudomonas aeruginosa (strain PA7)
P66513 4.79e-25 92 54 0 86 3 rpsT Small ribosomal subunit protein bS20 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P66512 4.79e-25 92 54 0 86 3 rpsT Small ribosomal subunit protein bS20 Xylella fastidiosa (strain 9a5c)
A5CW82 6.26e-25 91 56 0 86 3 rpsT Small ribosomal subunit protein bS20 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q3J6R8 8.01e-25 91 54 0 86 3 rpsT Small ribosomal subunit protein bS20 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B8GQQ5 2.66e-24 90 61 0 86 3 rpsT Small ribosomal subunit protein bS20 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q605N0 2.81e-24 90 55 0 86 3 rpsT Small ribosomal subunit protein bS20 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A9IQ52 3.08e-24 90 58 0 86 3 rpsT Small ribosomal subunit protein bS20 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q1GZ59 3.32e-24 90 58 0 86 3 rpsT Small ribosomal subunit protein bS20 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q1QA59 3.34e-24 90 55 0 86 3 rpsT Small ribosomal subunit protein bS20 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FRM3 3.57e-24 90 55 0 86 3 rpsT Small ribosomal subunit protein bS20 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B3PKU5 2.3e-23 87 61 0 86 3 rpsT Small ribosomal subunit protein bS20 Cellvibrio japonicus (strain Ueda107)
Q1R0B8 4.29e-23 87 56 0 86 3 rpsT Small ribosomal subunit protein bS20 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1WY45 5.11e-23 87 53 0 86 3 rpsT Small ribosomal subunit protein bS20 Halorhodospira halophila (strain DSM 244 / SL1)
A1KVG4 7.87e-23 86 54 0 86 3 rpsT Small ribosomal subunit protein bS20 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66508 7.87e-23 86 54 0 86 3 rpsT Small ribosomal subunit protein bS20 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66507 7.87e-23 86 54 0 86 3 rpsT Small ribosomal subunit protein bS20 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M260 7.87e-23 86 54 0 86 3 rpsT Small ribosomal subunit protein bS20 Neisseria meningitidis serogroup C (strain 053442)
B4RPA5 7.87e-23 86 54 0 86 3 rpsT Small ribosomal subunit protein bS20 Neisseria gonorrhoeae (strain NCCP11945)
Q5F6Q6 7.87e-23 86 54 0 86 3 rpsT Small ribosomal subunit protein bS20 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1TYY6 1.25e-22 85 55 0 86 3 rpsT Small ribosomal subunit protein bS20 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q7NRN3 1.27e-22 85 56 0 86 3 rpsT Small ribosomal subunit protein bS20 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A6W349 1.77e-22 85 56 0 86 3 rpsT Small ribosomal subunit protein bS20 Marinomonas sp. (strain MWYL1)
Q31ID5 3.12e-22 85 58 0 86 3 rpsT Small ribosomal subunit protein bS20 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q2KZD7 3.76e-22 84 54 0 86 3 rpsT Small ribosomal subunit protein bS20 Bordetella avium (strain 197N)
Q47BL6 8.83e-22 84 54 0 86 3 rpsT Small ribosomal subunit protein bS20 Dechloromonas aromatica (strain RCB)
B5EKY1 1.25e-21 83 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J5H6 1.25e-21 83 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q8PBG9 2.12e-21 82 58 0 86 3 rpsT Small ribosomal subunit protein bS20 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RY31 2.12e-21 82 58 0 86 3 rpsT Small ribosomal subunit protein bS20 Xanthomonas campestris pv. campestris (strain B100)
Q4US37 2.12e-21 82 58 0 86 3 rpsT Small ribosomal subunit protein bS20 Xanthomonas campestris pv. campestris (strain 8004)
Q7VVA6 2.53e-21 82 53 0 86 3 rpsT Small ribosomal subunit protein bS20 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W7G3 2.53e-21 82 53 0 86 3 rpsT Small ribosomal subunit protein bS20 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WKV2 2.53e-21 82 53 0 86 3 rpsT Small ribosomal subunit protein bS20 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q5H2E4 3.11e-21 82 58 0 86 3 rpsT Small ribosomal subunit protein bS20 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2STC1 3.11e-21 82 58 0 86 3 rpsT Small ribosomal subunit protein bS20 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P5B3 3.11e-21 82 58 0 86 3 rpsT Small ribosomal subunit protein bS20 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BW45 3.11e-21 82 58 0 86 3 rpsT Small ribosomal subunit protein bS20 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PN22 3.11e-21 82 58 0 86 3 rpsT Small ribosomal subunit protein bS20 Xanthomonas axonopodis pv. citri (strain 306)
Q2S9T5 6.83e-21 81 53 0 86 3 rpsT Small ribosomal subunit protein bS20 Hahella chejuensis (strain KCTC 2396)
A1BAN4 7.22e-21 81 50 0 86 3 rpsT Small ribosomal subunit protein bS20 Paracoccus denitrificans (strain Pd 1222)
C4L434 1.05e-20 81 54 0 86 3 rpsT Small ribosomal subunit protein bS20 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q89AU8 1.26e-20 80 58 0 86 3 rpsT Small ribosomal subunit protein bS20 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q7VQL2 1.65e-20 80 52 0 86 3 rpsT Small ribosomal subunit protein bS20 Blochmanniella floridana
Q057X8 1.94e-20 80 48 0 86 3 rpsT Small ribosomal subunit protein bS20 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
A1K7K2 2.55e-20 80 55 0 86 3 rpsT Small ribosomal subunit protein bS20 Azoarcus sp. (strain BH72)
Q0AFG8 4.11e-20 79 50 0 86 3 rpsT Small ribosomal subunit protein bS20 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q82SI6 5.59e-20 79 50 0 86 3 rpsT Small ribosomal subunit protein bS20 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B8EMX4 7.88e-20 79 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A8LNL0 7.88e-20 79 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
C1DBS9 8.28e-20 79 54 0 86 3 rpsT Small ribosomal subunit protein bS20 Laribacter hongkongensis (strain HLHK9)
B2FTI7 1.28e-19 78 56 0 86 3 rpsT Small ribosomal subunit protein bS20 Stenotrophomonas maltophilia (strain K279a)
B4SP15 1.44e-19 78 58 0 86 3 rpsT Small ribosomal subunit protein bS20 Stenotrophomonas maltophilia (strain R551-3)
Q3SHS6 2.01e-19 77 52 0 86 3 rpsT Small ribosomal subunit protein bS20 Thiobacillus denitrificans (strain ATCC 25259)
Q0BVU4 2.41e-19 77 48 0 86 3 rpsT Small ribosomal subunit protein bS20 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q2RMP9 3.19e-19 77 50 0 86 3 rpsT Small ribosomal subunit protein bS20 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A4IR39 4.91e-19 77 53 0 86 3 rpsT Small ribosomal subunit protein bS20 Geobacillus thermodenitrificans (strain NG80-2)
Q0C4P9 7.37e-19 76 48 0 86 3 rpsT Small ribosomal subunit protein bS20 Hyphomonas neptunium (strain ATCC 15444)
C5D4V0 7.44e-19 76 53 0 86 3 rpsT Small ribosomal subunit protein bS20 Geobacillus sp. (strain WCH70)
B6IVU7 8.26e-19 76 50 0 86 3 rpsT Small ribosomal subunit protein bS20 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q16DK7 8.59e-19 76 52 0 86 3 rpsT Small ribosomal subunit protein bS20 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q5P102 1.17e-18 75 53 0 86 3 rpsT Small ribosomal subunit protein bS20 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
P66502 1.8e-18 75 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Brucella suis biovar 1 (strain 1330)
B0CK30 1.8e-18 75 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Brucella suis (strain ATCC 23445 / NCTC 10510)
P66501 1.8e-18 75 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RG67 1.8e-18 75 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Brucella melitensis biotype 2 (strain ATCC 23457)
A9MAB4 1.8e-18 75 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57A81 1.8e-18 75 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Brucella abortus biovar 1 (strain 9-941)
Q2YQP6 1.8e-18 75 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Brucella abortus (strain 2308)
B2S9T4 1.8e-18 75 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Brucella abortus (strain S19)
Q1GC53 2.27e-18 75 52 0 86 3 rpsT Small ribosomal subunit protein bS20 Ruegeria sp. (strain TM1040)
A1UU77 2.58e-18 75 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q5KWY9 3.01e-18 75 52 0 86 3 rpsT Small ribosomal subunit protein bS20 Geobacillus kaustophilus (strain HTA426)
Q46XK7 4.7e-18 74 52 0 86 3 rpsT Small ribosomal subunit protein bS20 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A9VHU9 5.77e-18 73 51 0 85 3 rpsT Small ribosomal subunit protein bS20 Bacillus mycoides (strain KBAB4)
Q83ED6 6.36e-18 74 48 0 86 3 rpsT Small ribosomal subunit protein bS20 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBL7 6.36e-18 74 48 0 86 3 rpsT Small ribosomal subunit protein bS20 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KEJ4 6.36e-18 74 48 0 86 3 rpsT Small ribosomal subunit protein bS20 Coxiella burnetii (strain Dugway 5J108-111)
B6J1S7 6.36e-18 74 48 0 86 3 rpsT Small ribosomal subunit protein bS20 Coxiella burnetii (strain CbuG_Q212)
B6J9J9 6.36e-18 74 48 0 86 3 rpsT Small ribosomal subunit protein bS20 Coxiella burnetii (strain CbuK_Q154)
A9HI31 6.77e-18 73 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q8XWB8 1.07e-17 73 51 0 86 3 rpsT Small ribosomal subunit protein bS20 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q6HDJ9 1.61e-17 73 51 0 85 3 rpsT Small ribosomal subunit protein bS20 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q634L9 1.61e-17 73 51 0 85 3 rpsT Small ribosomal subunit protein bS20 Bacillus cereus (strain ZK / E33L)
Q818E1 1.61e-17 73 51 0 85 3 rpsT Small ribosomal subunit protein bS20 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IY89 1.61e-17 73 51 0 85 3 rpsT Small ribosomal subunit protein bS20 Bacillus cereus (strain Q1)
A7GT17 1.61e-17 73 51 0 85 3 rpsT Small ribosomal subunit protein bS20 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7HPM1 1.61e-17 73 51 0 85 3 rpsT Small ribosomal subunit protein bS20 Bacillus cereus (strain AH187)
B7HCU8 1.61e-17 73 51 0 85 3 rpsT Small ribosomal subunit protein bS20 Bacillus cereus (strain B4264)
C1ESL6 1.61e-17 73 51 0 85 3 rpsT Small ribosomal subunit protein bS20 Bacillus cereus (strain 03BB102)
Q730L3 1.61e-17 73 51 0 85 3 rpsT Small ribosomal subunit protein bS20 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JNV4 1.61e-17 73 51 0 85 3 rpsT Small ribosomal subunit protein bS20 Bacillus cereus (strain AH820)
Q81LR4 1.61e-17 73 51 0 85 3 rpsT Small ribosomal subunit protein bS20 Bacillus anthracis
C3L5S5 1.61e-17 73 51 0 85 3 rpsT Small ribosomal subunit protein bS20 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P8M8 1.61e-17 73 51 0 85 3 rpsT Small ribosomal subunit protein bS20 Bacillus anthracis (strain A0248)
A6WUS9 2.85e-17 72 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B7IYH5 3.86e-17 72 50 0 85 3 rpsT Small ribosomal subunit protein bS20 Bacillus cereus (strain G9842)
Q1LJ99 4.66e-17 72 51 0 86 3 rpsT Small ribosomal subunit protein bS20 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B3PZ95 4.84e-17 72 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Rhizobium etli (strain CIAT 652)
Q6G0V7 5.08e-17 71 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Bartonella quintana (strain Toulouse)
Q2KDA7 5.17e-17 72 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q5LWV5 5.29e-17 71 48 0 86 3 rpsT Small ribosomal subunit protein bS20 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q1MMD7 6.29e-17 71 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B1YKS4 8.33e-17 71 50 0 86 3 rpsT Small ribosomal subunit protein bS20 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B5ZYL1 1.1e-16 71 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q2LQK7 1.12e-16 70 47 0 85 3 rpsT Small ribosomal subunit protein bS20 Syntrophus aciditrophicus (strain SB)
Q2YA81 1.48e-16 70 51 0 86 3 rpsT Small ribosomal subunit protein bS20 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A9ILY6 1.53e-16 70 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Bartonella tribocorum (strain CIP 105476 / IBS 506)
A7HNZ1 1.58e-16 70 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q5WHG9 1.64e-16 70 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Shouchella clausii (strain KSM-K16)
B9J7T1 2.48e-16 70 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q9Z5V0 3.94e-16 69 44 0 86 3 rpsT Small ribosomal subunit protein bS20 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A4G7U3 4.6e-16 69 53 0 77 3 rpsT Small ribosomal subunit protein bS20 Herminiimonas arsenicoxydans
A6T112 6.59e-16 68 53 0 77 3 rpsT Small ribosomal subunit protein bS20 Janthinobacterium sp. (strain Marseille)
Q6G527 8.79e-16 68 44 0 86 3 rpsT Small ribosomal subunit protein bS20 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A2SK91 9.8e-16 68 48 0 83 3 rpsT Small ribosomal subunit protein bS20 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B0ULZ9 1.33e-15 68 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Methylobacterium sp. (strain 4-46)
C5C483 1.49e-15 68 44 0 86 3 rpsT Small ribosomal subunit protein bS20 Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
A9W9L9 1.62e-15 68 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Methylorubrum extorquens (strain PA1)
B7KZZ9 1.62e-15 68 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B2V2H7 1.88e-15 67 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Clostridium botulinum (strain Alaska E43 / Type E3)
A5VG07 2.03e-15 67 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B8IQW2 2.35e-15 67 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q9KD79 3.47e-15 67 48 0 85 3 rpsT Small ribosomal subunit protein bS20 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B2SY60 3.6e-15 67 50 0 86 3 rpsT Small ribosomal subunit protein bS20 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B1XRS9 5.38e-15 66 52 0 86 3 rpsT Small ribosomal subunit protein bS20 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
B2GHV1 5.76e-15 66 43 0 83 3 rpsT Small ribosomal subunit protein bS20 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
A7Z6W9 6.4e-15 66 41 0 86 3 rpsT Small ribosomal subunit protein bS20 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B2TLY9 6.88e-15 66 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Clostridium botulinum (strain Eklund 17B / Type B)
Q2GCX9 9.04e-15 66 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q8UIH2 1.12e-14 65 44 0 86 3 rpsT Small ribosomal subunit protein bS20 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0AK35 1.13e-14 65 43 0 86 3 rpsT Small ribosomal subunit protein bS20 Maricaulis maris (strain MCS10)
Q28JI3 1.29e-14 65 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Jannaschia sp. (strain CCS1)
B1ZE36 1.52e-14 65 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q13UR4 1.62e-14 65 50 0 86 3 rpsT Small ribosomal subunit protein bS20 Paraburkholderia xenovorans (strain LB400)
Q5FN16 1.64e-14 65 52 0 86 3 rpsT Small ribosomal subunit protein bS20 Gluconobacter oxydans (strain 621H)
Q11AV6 2.01e-14 65 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Chelativorans sp. (strain BNC1)
Q2S440 2.12e-14 65 45 1 86 3 rpsT Small ribosomal subunit protein bS20 Salinibacter ruber (strain DSM 13855 / M31)
A0LD67 2.2e-14 65 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
P21477 2.24e-14 65 40 0 86 1 rpsT Small ribosomal subunit protein bS20 Bacillus subtilis (strain 168)
B4RC46 2.74e-14 65 43 0 86 3 rpsT Small ribosomal subunit protein bS20 Phenylobacterium zucineum (strain HLK1)
A1VRN0 3.58e-14 65 45 0 81 3 rpsT Small ribosomal subunit protein bS20 Polaromonas naphthalenivorans (strain CJ2)
Q97JK0 3.79e-14 64 44 0 86 3 rpsT Small ribosomal subunit protein bS20 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q2T0K8 3.88e-14 64 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63WM0 3.88e-14 64 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia pseudomallei (strain K96243)
A3N6J9 3.88e-14 64 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia pseudomallei (strain 668)
Q3JVB6 3.88e-14 64 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia pseudomallei (strain 1710b)
A3NS83 3.88e-14 64 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia pseudomallei (strain 1106a)
A1V1C0 3.88e-14 64 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia mallei (strain SAVP1)
Q62M74 3.88e-14 64 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia mallei (strain ATCC 23344)
A2S951 3.88e-14 64 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia mallei (strain NCTC 10229)
A3MHG9 3.88e-14 64 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia mallei (strain NCTC 10247)
A4SZQ5 3.91e-14 64 50 0 86 3 rpsT Small ribosomal subunit protein bS20 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B1M565 4.13e-14 64 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q21WK7 4.52e-14 64 46 0 81 3 rpsT Small ribosomal subunit protein bS20 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
C5CSK7 5.56e-14 64 45 0 83 3 rpsT Small ribosomal subunit protein bS20 Variovorax paradoxus (strain S110)
A5G360 5.77e-14 63 44 0 86 3 rpsT Small ribosomal subunit protein bS20 Acidiphilium cryptum (strain JF-5)
B9JZF6 5.79e-14 63 44 0 86 3 rpsT Small ribosomal subunit protein bS20 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A5EXX2 6.46e-14 63 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Dichelobacter nodosus (strain VCS1703A)
A6LRM5 7.26e-14 63 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q7UPC9 7.82e-14 63 47 0 84 3 rpsT Small ribosomal subunit protein bS20 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q126R4 8.85e-14 63 47 0 78 3 rpsT Small ribosomal subunit protein bS20 Polaromonas sp. (strain JS666 / ATCC BAA-500)
C3MCY9 1.02e-13 63 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q1IKQ3 1.09e-13 63 42 0 85 3 rpsT Small ribosomal subunit protein bS20 Koribacter versatilis (strain Ellin345)
B9M9F6 1.15e-13 63 43 0 86 3 rpsT Small ribosomal subunit protein bS20 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B1VGK8 1.21e-13 63 41 0 86 3 rpsT Small ribosomal subunit protein bS20 Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q2W9N6 1.24e-13 63 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B8DUL7 1.49e-13 62 48 0 86 3 rpsT Small ribosomal subunit protein bS20 Bifidobacterium animalis subsp. lactis (strain AD011)
Q8EPW0 1.52e-13 62 43 0 86 3 rpsT Small ribosomal subunit protein bS20 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B5Y8K5 1.69e-13 62 41 0 79 3 rpsT Small ribosomal subunit protein bS20 Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
A8HQ27 2.36e-13 62 45 0 84 3 rpsT Small ribosomal subunit protein bS20 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q1GN81 3.57e-13 62 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B2JDU7 3.58e-13 62 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A4JH83 4.19e-13 62 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BU63 4.19e-13 62 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia orbicola (strain AU 1054)
B1JXG1 4.19e-13 62 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia orbicola (strain MC0-3)
Q0BCG7 4.19e-13 62 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E9G4 4.19e-13 62 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K9X4 4.19e-13 62 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia cenocepacia (strain HI2424)
B1YVE4 4.19e-13 62 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia ambifaria (strain MC40-6)
A5N6L4 4.59e-13 61 43 0 83 3 rpsT Small ribosomal subunit protein bS20 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E033 4.59e-13 61 43 0 83 3 rpsT Small ribosomal subunit protein bS20 Clostridium kluyveri (strain NBRC 12016)
Q39DI9 4.67e-13 61 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q4JWS3 4.73e-13 61 43 0 86 3 rpsT Small ribosomal subunit protein bS20 Corynebacterium jeikeium (strain K411)
Q0SRD4 5.51e-13 61 44 0 86 3 rpsT Small ribosomal subunit protein bS20 Clostridium perfringens (strain SM101 / Type A)
Q0TNR8 5.51e-13 61 44 0 86 3 rpsT Small ribosomal subunit protein bS20 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q98BG8 7.02e-13 61 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8XIS2 7.08e-13 61 44 0 86 3 rpsT Small ribosomal subunit protein bS20 Clostridium perfringens (strain 13 / Type A)
C6E105 7.56e-13 61 43 0 86 3 rpsT Small ribosomal subunit protein bS20 Geobacter sp. (strain M21)
B5EE44 7.56e-13 61 43 0 86 3 rpsT Small ribosomal subunit protein bS20 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A1TBY9 7.96e-13 61 43 0 80 3 rpsT Small ribosomal subunit protein bS20 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
P48948 8.36e-13 61 41 0 86 3 rpsT Small ribosomal subunit protein bS20 Rhizobium meliloti (strain 1021)
A9AGJ8 8.88e-13 61 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Burkholderia multivorans (strain ATCC 17616 / 249)
Q8NN66 9.2e-13 60 48 0 80 3 rpsT Small ribosomal subunit protein bS20 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QG64 9.2e-13 60 48 0 80 3 rpsT Small ribosomal subunit protein bS20 Corynebacterium glutamicum (strain R)
A9KKU7 9.61e-13 60 45 0 80 3 rpsT Small ribosomal subunit protein bS20 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A6U5D1 1.04e-12 60 43 0 86 3 rpsT Small ribosomal subunit protein bS20 Sinorhizobium medicae (strain WSM419)
A1TLC1 1.08e-12 61 48 0 77 3 rpsT Small ribosomal subunit protein bS20 Paracidovorax citrulli (strain AAC00-1)
A8FFE0 1.12e-12 60 41 0 86 3 rpsT Small ribosomal subunit protein bS20 Bacillus pumilus (strain SAFR-032)
Q2N7Y7 1.23e-12 60 43 0 86 3 rpsT Small ribosomal subunit protein bS20 Erythrobacter litoralis (strain HTCC2594)
Q182G1 1.57e-12 60 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Clostridioides difficile (strain 630)
B9KQK1 1.62e-12 60 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3IY62 1.62e-12 60 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PFL4 1.62e-12 60 45 0 86 3 rpsT Small ribosomal subunit protein bS20 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B2IAW0 1.85e-12 60 48 0 86 3 rpsT Small ribosomal subunit protein bS20 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B8H8S5 2.15e-12 60 39 0 86 3 rpsT Small ribosomal subunit protein bS20 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
B3E3K5 2.67e-12 59 40 0 86 3 rpsT Small ribosomal subunit protein bS20 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B0RDA1 2.7e-12 59 43 0 83 3 rpsT Small ribosomal subunit protein bS20 Clavibacter sepedonicus
Q8RHW1 2.84e-12 59 40 0 86 3 rpsT Small ribosomal subunit protein bS20 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B1VY27 2.99e-12 59 41 0 86 3 rpsT Small ribosomal subunit protein bS20 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
C0ZB21 3.11e-12 59 44 0 86 3 rpsT Small ribosomal subunit protein bS20 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A5CR93 3.44e-12 59 43 0 83 3 rpsT Small ribosomal subunit protein bS20 Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
A6WDJ6 4.45e-12 59 46 0 73 3 rpsT Small ribosomal subunit protein bS20 Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
A4T2G0 7.11e-12 58 42 0 80 3 rpsT Small ribosomal subunit protein bS20 Mycolicibacterium gilvum (strain PYR-GCK)
A4J7G2 7.96e-12 58 44 0 79 3 rpsT Small ribosomal subunit protein bS20 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A1R6X0 8.1e-12 58 39 0 86 3 rpsT Small ribosomal subunit protein bS20 Paenarthrobacter aurescens (strain TC1)
Q8FNA1 8.67e-12 58 46 0 80 3 rpsT Small ribosomal subunit protein bS20 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A4WNE9 9.05e-12 58 46 0 86 3 rpsT Small ribosomal subunit protein bS20 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A0Q1S2 9.9e-12 58 41 0 86 3 rpsT Small ribosomal subunit protein bS20 Clostridium novyi (strain NT)
B2A1L9 1.1e-11 58 40 0 83 3 rpsT Small ribosomal subunit protein bS20 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B8GWW4 1.12e-11 58 40 0 86 3 rpsT Small ribosomal subunit protein bS20 Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW3 1.12e-11 58 40 0 86 3 rpsT Small ribosomal subunit protein bS20 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A1WIS4 1.22e-11 58 48 0 75 3 rpsT Small ribosomal subunit protein bS20 Verminephrobacter eiseniae (strain EF01-2)
B8F9F2 1.27e-11 58 38 0 86 3 rpsT Small ribosomal subunit protein bS20 Desulfatibacillum aliphaticivorans
Q6AEB3 1.44e-11 57 40 0 86 3 rpsT Small ribosomal subunit protein bS20 Leifsonia xyli subsp. xyli (strain CTCB07)
B1MN07 1.75e-11 57 43 0 80 3 rpsT Small ribosomal subunit protein bS20 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
B4UIK8 1.83e-11 57 41 0 79 3 rpsT Small ribosomal subunit protein bS20 Anaeromyxobacter sp. (strain K)
B8JEV0 1.83e-11 57 41 0 79 3 rpsT Small ribosomal subunit protein bS20 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A9WQT7 2.1e-11 57 38 0 86 3 rpsT Small ribosomal subunit protein bS20 Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
B0SJ57 2.28e-11 57 36 0 86 3 rpsT Small ribosomal subunit protein bS20 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SBL3 2.28e-11 57 36 0 86 3 rpsT Small ribosomal subunit protein bS20 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
C3L3H5 2.34e-11 57 40 0 86 3 rpsT Small ribosomal subunit protein bS20 Clostridium botulinum (strain 657 / Type Ba4)
B8G6M3 2.37e-11 57 46 2 86 3 rpsT Small ribosomal subunit protein bS20 Chloroflexus aggregans (strain MD-66 / DSM 9485)
B8CXL9 2.63e-11 57 38 0 83 3 rpsT Small ribosomal subunit protein bS20 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B0TAC7 2.69e-11 57 45 0 79 3 rpsT Small ribosomal subunit protein bS20 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A0LK18 3.12e-11 57 38 0 86 3 rpsT Small ribosomal subunit protein bS20 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A4XAE7 4.16e-11 56 43 0 83 3 rpsT Small ribosomal subunit protein bS20 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q1B667 4.33e-11 56 40 0 83 3 rpsT Small ribosomal subunit protein bS20 Mycobacterium sp. (strain MCS)
A1UIW8 4.33e-11 56 40 0 83 3 rpsT Small ribosomal subunit protein bS20 Mycobacterium sp. (strain KMS)
A3Q2C2 4.33e-11 56 40 0 83 3 rpsT Small ribosomal subunit protein bS20 Mycobacterium sp. (strain JLS)
B1KZP5 4.39e-11 56 39 0 86 3 rpsT Small ribosomal subunit protein bS20 Clostridium botulinum (strain Loch Maree / Type A3)
A7GHI4 4.39e-11 56 39 0 86 3 rpsT Small ribosomal subunit protein bS20 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1ILN1 4.39e-11 56 39 0 86 3 rpsT Small ribosomal subunit protein bS20 Clostridium botulinum (strain Okra / Type B1)
C1FVU8 4.39e-11 56 39 0 86 3 rpsT Small ribosomal subunit protein bS20 Clostridium botulinum (strain Kyoto / Type A2)
A5I648 4.39e-11 56 39 0 86 3 rpsT Small ribosomal subunit protein bS20 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FXM3 4.39e-11 56 39 0 86 3 rpsT Small ribosomal subunit protein bS20 Clostridium botulinum (strain ATCC 19397 / Type A)
C0QI73 4.39e-11 56 50 1 74 3 rpsT Small ribosomal subunit protein bS20 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B0S1G4 4.94e-11 56 42 0 83 3 rpsT Small ribosomal subunit protein bS20 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
A1WA60 5.33e-11 57 45 0 77 3 rpsT Small ribosomal subunit protein bS20 Acidovorax sp. (strain JS42)
B9MCT1 5.33e-11 57 45 0 77 3 rpsT Small ribosomal subunit protein bS20 Acidovorax ebreus (strain TPSY)
Q12ZV2 5.46e-11 56 39 0 83 3 rpsT Small ribosomal subunit protein bS20 Rhodopseudomonas palustris (strain BisB5)
Q6A9B3 6.22e-11 56 39 0 86 1 rpsT Small ribosomal subunit protein bS20 Cutibacterium acnes (strain DSM 16379 / KPA171202)
A0R102 6.26e-11 56 43 0 80 1 rpsT Small ribosomal subunit protein bS20 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q03L31 6.43e-11 56 43 1 83 3 rpsT Small ribosomal subunit protein bS20 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
B6JCV5 1.04e-10 55 42 0 83 3 rpsT Small ribosomal subunit protein bS20 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q2IQW5 1.13e-10 55 40 0 83 3 rpsT Small ribosomal subunit protein bS20 Rhodopseudomonas palustris (strain HaA2)
Q2ILG4 1.22e-10 55 39 0 79 3 rpsT Small ribosomal subunit protein bS20 Anaeromyxobacter dehalogenans (strain 2CP-C)
A9NGM5 1.53e-10 55 40 0 86 3 rpsT Small ribosomal subunit protein bS20 Acholeplasma laidlawii (strain PG-8A)
Q02XD6 1.6e-10 55 43 1 83 3 rpsT Small ribosomal subunit protein bS20 Lactococcus lactis subsp. cremoris (strain SK11)
A2RMG0 1.6e-10 55 43 1 83 1 rpsT Small ribosomal subunit protein bS20 Lactococcus lactis subsp. cremoris (strain MG1363)
A1SHW4 1.7e-10 55 42 0 80 3 rpsT Small ribosomal subunit protein bS20 Nocardioides sp. (strain ATCC BAA-499 / JS614)
B8HTW2 1.74e-10 55 41 1 87 3 rpsT Small ribosomal subunit protein bS20 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
B1LB18 1.93e-10 55 41 1 84 3 rpsT Small ribosomal subunit protein bS20 Thermotoga sp. (strain RQ2)
Q9X1Y7 1.93e-10 55 41 1 84 3 rpsT Small ribosomal subunit protein bS20 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q5M4T9 1.97e-10 55 42 1 83 3 rpsT Small ribosomal subunit protein bS20 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M080 1.97e-10 55 42 1 83 3 rpsT Small ribosomal subunit protein bS20 Streptococcus thermophilus (strain CNRZ 1066)
A8M0X6 2.15e-10 55 42 0 83 3 rpsT Small ribosomal subunit protein bS20 Salinispora arenicola (strain CNS-205)
Q2G300 2.28e-10 54 41 0 86 3 rpsT Small ribosomal subunit protein bS20 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B9LJI4 2.47e-10 55 48 4 87 3 rpsT Small ribosomal subunit protein bS20 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WHB7 2.47e-10 55 48 4 87 3 rpsT Small ribosomal subunit protein bS20 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
C5CCD6 2.53e-10 54 47 0 86 3 rpsT Small ribosomal subunit protein bS20 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
B9KZD4 2.89e-10 55 48 0 86 3 rpsT Small ribosomal subunit protein bS20 Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
P66503 3.15e-10 54 45 1 83 1 rpsT Small ribosomal subunit protein bS20 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DE31 3.15e-10 54 45 1 83 3 rpsT Small ribosomal subunit protein bS20 Listeria monocytogenes serotype 4a (strain HCC23)
Q71ZJ0 3.15e-10 54 45 1 83 3 rpsT Small ribosomal subunit protein bS20 Listeria monocytogenes serotype 4b (strain F2365)
C1KVC7 3.15e-10 54 45 1 83 3 rpsT Small ribosomal subunit protein bS20 Listeria monocytogenes serotype 4b (strain CLIP80459)
P66504 3.15e-10 54 45 1 83 3 rpsT Small ribosomal subunit protein bS20 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9CEU5 3.22e-10 54 43 1 83 3 rpsT Small ribosomal subunit protein bS20 Lactococcus lactis subsp. lactis (strain IL1403)
Q3A4P5 4.58e-10 53 43 0 74 3 rpsT Small ribosomal subunit protein bS20 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A0T0R2 4.67e-10 54 36 1 92 3 rps20 Small ribosomal subunit protein bS20c Thalassiosira pseudonana
A8ZVQ3 4.85e-10 53 42 0 85 3 rpsT Small ribosomal subunit protein bS20 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
B8I3I4 5.5e-10 53 41 1 85 3 rpsT Small ribosomal subunit protein bS20 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B2UM23 5.76e-10 53 44 0 77 3 rpsT Small ribosomal subunit protein bS20 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
B2UBA6 6.57e-10 53 52 0 86 3 rpsT Small ribosomal subunit protein bS20 Ralstonia pickettii (strain 12J)
A1APW6 6.63e-10 53 38 0 86 3 rpsT Small ribosomal subunit protein bS20 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q73XT5 6.69e-10 53 43 0 80 3 rpsT Small ribosomal subunit protein bS20 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QDK7 6.69e-10 53 43 0 80 3 rpsT Small ribosomal subunit protein bS20 Mycobacterium avium (strain 104)
A4XIA5 6.94e-10 53 41 0 79 3 rpsT Small ribosomal subunit protein bS20 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q1AVU9 8.03e-10 53 43 0 66 3 rpsT Small ribosomal subunit protein bS20 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q46J20 8.81e-10 53 34 1 91 3 rpsT Small ribosomal subunit protein bS20 Prochlorococcus marinus (strain NATL2A)
A2C4N4 8.81e-10 53 34 1 91 3 rpsT Small ribosomal subunit protein bS20 Prochlorococcus marinus (strain NATL1A)
B9K7H3 8.81e-10 53 40 1 84 3 rpsT Small ribosomal subunit protein bS20 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q9RDM3 9e-10 53 43 0 86 3 rpsT Small ribosomal subunit protein bS20 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C0R453 9.31e-10 53 41 0 86 3 rpsT Small ribosomal subunit protein bS20 Wolbachia sp. subsp. Drosophila simulans (strain wRi)
A8GPC4 1.04e-09 53 41 0 86 3 rpsT Small ribosomal subunit protein bS20 Rickettsia akari (strain Hartford)
A6LNU3 1.09e-09 53 39 1 84 3 rpsT Small ribosomal subunit protein bS20 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
B0C2C8 1.13e-09 53 39 2 92 3 rpsT Small ribosomal subunit protein bS20 Acaryochloris marina (strain MBIC 11017)
C1CVD5 1.15e-09 53 45 1 79 3 rpsT Small ribosomal subunit protein bS20 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
A0AIS9 1.17e-09 53 44 1 83 3 rpsT Small ribosomal subunit protein bS20 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B7IEV3 1.21e-09 53 40 1 84 3 rpsT Small ribosomal subunit protein bS20 Thermosipho africanus (strain TCF52B)
Q8RB79 1.24e-09 53 38 0 86 3 rpsT Small ribosomal subunit protein bS20 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A0PTY6 1.48e-09 52 42 0 80 3 rpsT Small ribosomal subunit protein bS20 Mycobacterium ulcerans (strain Agy99)
B2HMC9 1.48e-09 52 42 0 80 3 rpsT Small ribosomal subunit protein bS20 Mycobacterium marinum (strain ATCC BAA-535 / M)
A0JX52 1.53e-09 52 38 0 86 3 rpsT Small ribosomal subunit protein bS20 Arthrobacter sp. (strain FB24)
Q38WR3 1.75e-09 52 46 1 79 3 rpsT Small ribosomal subunit protein bS20 Latilactobacillus sakei subsp. sakei (strain 23K)
B9MKZ9 1.76e-09 52 40 0 79 3 rpsT Small ribosomal subunit protein bS20 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q65H46 1.84e-09 52 40 0 86 3 rpsT Small ribosomal subunit protein bS20 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A8EZJ0 1.95e-09 52 41 0 86 3 rpsT Small ribosomal subunit protein bS20 Rickettsia canadensis (strain McKiel)
A5EU55 1.97e-09 52 40 0 83 3 rpsT Small ribosomal subunit protein bS20 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A5CCI7 1.97e-09 52 39 0 86 3 rpsT Small ribosomal subunit protein bS20 Orientia tsutsugamushi (strain Boryong)
B0JGK4 2e-09 52 39 1 87 3 rpsT Small ribosomal subunit protein bS20 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
O33132 2.09e-09 52 41 0 80 3 rpsT Small ribosomal subunit protein bS20 Mycobacterium leprae (strain TN)
B8ZUR8 2.09e-09 52 41 0 80 3 rpsT Small ribosomal subunit protein bS20 Mycobacterium leprae (strain Br4923)
B5XLR6 2.23e-09 52 42 1 83 3 rpsT Small ribosomal subunit protein bS20 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE85 2.23e-09 52 42 1 83 3 rpsT Small ribosomal subunit protein bS20 Streptococcus pyogenes serotype M3 (strain SSI-1)
A2REA5 2.23e-09 52 42 1 83 3 rpsT Small ribosomal subunit protein bS20 Streptococcus pyogenes serotype M5 (strain Manfredo)
P66511 2.23e-09 52 42 1 83 3 rpsT Small ribosomal subunit protein bS20 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XBZ3 2.23e-09 52 42 1 83 3 rpsT Small ribosomal subunit protein bS20 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE84 2.23e-09 52 42 1 83 3 rpsT Small ribosomal subunit protein bS20 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66509 2.23e-09 52 42 1 83 3 rpsT Small ribosomal subunit protein bS20 Streptococcus pyogenes serotype M1
C0QU24 2.27e-09 52 47 0 74 3 rpsT Small ribosomal subunit protein bS20 Persephonella marina (strain DSM 14350 / EX-H1)
A8GT43 2.32e-09 52 41 0 86 3 rpsT Small ribosomal subunit protein bS20 Rickettsia rickettsii (strain Sheila Smith)
C4K2F3 2.32e-09 52 41 0 86 3 rpsT Small ribosomal subunit protein bS20 Rickettsia peacockii (strain Rustic)
C3PP81 2.32e-09 52 41 0 86 3 rpsT Small ribosomal subunit protein bS20 Rickettsia africae (strain ESF-5)
Q92GZ2 2.43e-09 52 41 0 86 3 rpsT Small ribosomal subunit protein bS20 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A5UXT6 2.45e-09 52 46 1 79 3 rpsT Small ribosomal subunit protein bS20 Roseiflexus sp. (strain RS-1)
Q2JDK3 2.47e-09 52 40 0 80 3 rpsT Small ribosomal subunit protein bS20 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
A4Z3J9 2.55e-09 52 40 0 83 3 rpsT Small ribosomal subunit protein bS20 Bradyrhizobium sp. (strain ORS 278)
Q97RH7 2.63e-09 52 40 1 83 3 rpsT Small ribosomal subunit protein bS20 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
C1CJS7 2.75e-09 52 40 1 83 3 rpsT Small ribosomal subunit protein bS20 Streptococcus pneumoniae (strain P1031)
Q8CWS0 2.75e-09 52 40 1 83 3 rpsT Small ribosomal subunit protein bS20 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B1IB07 2.75e-09 52 40 1 83 3 rpsT Small ribosomal subunit protein bS20 Streptococcus pneumoniae (strain Hungary19A-6)
C1C6H2 2.75e-09 52 40 1 83 3 rpsT Small ribosomal subunit protein bS20 Streptococcus pneumoniae (strain 70585)
Q04L74 2.75e-09 52 40 1 83 3 rpsT Small ribosomal subunit protein bS20 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P49507 2.8e-09 52 38 2 91 3 rps20 Small ribosomal subunit protein bS20c Trieres chinensis

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_06460
Feature type CDS
Gene rpsT
Product 30S ribosomal protein S20
Location 131670 - 131930 (strand: 1)
Length 261 (nucleotides) / 86 (amino acids)
In genomic island -

Contig

Accession contig_6
Length 178871 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1194
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01649 Ribosomal protein S20

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0268 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S20

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02968 small subunit ribosomal protein S20 Ribosome -

Protein Sequence

MANIKSAKKRAIQSEKRRQHNASRRSMVRTFIKKVYAAIAAGDKEAAQNAFNDMQPLVDRHAAKGLIHKNKAARHKANLAAQIKAM

Flanking regions ( +/- flanking 50bp)

ATTCCTCCACCTTTGTATTGTCCTCGAAGAATATATTTGGGAGTTGGACCTTGGCTAATATCAAATCAGCTAAGAAACGCGCCATTCAGTCTGAAAAACGTCGTCAGCATAACGCTAGCCGTCGTTCTATGGTGCGCACCTTTATCAAGAAGGTTTACGCTGCTATCGCTGCCGGCGACAAAGAAGCTGCTCAGAACGCATTTAATGACATGCAACCACTTGTGGATCGTCACGCTGCTAAAGGCCTGATCCATAAGAACAAGGCTGCCCGTCATAAGGCGAACCTGGCTGCTCAGATCAAAGCAATGTAATCTGATTGTGCAGACATAAAAAAACCGGCTGATGCCGGTTTTTTTATGTC