Homologs in group_3254

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_11850 EHELCC_11850 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_12190 NLDBIP_12190 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_12050 LHKJJB_12050 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_10665 HKOGLL_10665 100.0 Morganella morganii S5 - hypothetical protein

Distribution of the homologs in the orthogroup group_3254

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3254

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_05740
Feature type CDS
Gene -
Product hypothetical protein
Location 151399 - 151506 (strand: 1)
Length 108 (nucleotides) / 35 (amino acids)

Contig

Accession contig_5
Length 181448 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3254
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MKRYYNWICRHKLYTLLIAFIVTDIILWAILSFTM

Flanking regions ( +/- flanking 50bp)

CCGGTAAACCCGTTATATTTAAGATTCCGCAGTCATACGGGGAAGACAGAATGAAACGCTATTATAACTGGATCTGCCGCCATAAGCTGTACACCCTGCTTATCGCCTTTATTGTGACGGATATCATTTTGTGGGCGATTTTGTCTTTCACCATGTGAATAACATCACCCCGGTATTTCACGCTGTTTTTTATGACAAAACTTGTTAA