Homologs in group_3234

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_06505 EHELCC_06505 100.0 Morganella morganii S2 - Subunit of ATP synthase
NLDBIP_06830 NLDBIP_06830 100.0 Morganella morganii S4 - Subunit of ATP synthase
LHKJJB_06365 LHKJJB_06365 100.0 Morganella morganii S3 - Subunit of ATP synthase
HKOGLL_04565 HKOGLL_04565 100.0 Morganella morganii S5 - Subunit of ATP synthase

Distribution of the homologs in the orthogroup group_3234

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3234

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_04030
Feature type CDS
Gene -
Product Subunit of ATP synthase
Location 203453 - 203650 (strand: -1)
Length 198 (nucleotides) / 65 (amino acids)

Contig

Accession contig_3
Length 210665 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3234
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MLPPIWPSDGVDSPAFWLAVLMWCVFFVVMRLLGKKNRPARRHRHCHGKESRVPEKENPSDPPWG

Flanking regions ( +/- flanking 50bp)

CATTACCCAGTTCTGATCACGGAAACCGGGTTGACCCAGCAGGTGAAGTAATGTTACCGCCGATATGGCCTTCAGATGGGGTTGACTCCCCGGCATTCTGGTTGGCCGTGCTGATGTGGTGCGTGTTCTTTGTTGTGATGAGACTCCTGGGGAAAAAAAACCGTCCTGCCCGCCGTCATCGTCACTGTCACGGGAAAGAATCGCGTGTACCGGAAAAAGAAAATCCGTCAGATCCTCCCTGGGGTTGAGTGCAGTGAGCACATTGTTTTCCGGACGTGTCGGTGAATTTTCAAACAGT