Homologs in group_2637

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_06535 EHELCC_06535 100.0 Morganella morganii S2 - TIGR03745 family integrating conjugative element membrane protein
NLDBIP_06860 NLDBIP_06860 100.0 Morganella morganii S4 - TIGR03745 family integrating conjugative element membrane protein
LHKJJB_06395 LHKJJB_06395 100.0 Morganella morganii S3 - TIGR03745 family integrating conjugative element membrane protein
HKOGLL_04535 HKOGLL_04535 100.0 Morganella morganii S5 - TIGR03745 family integrating conjugative element membrane protein
PMI_RS12755 PMI_RS12755 100.0 Proteus mirabilis HI4320 - TIGR03745 family integrating conjugative element membrane protein

Distribution of the homologs in the orthogroup group_2637

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2637

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_04000
Feature type CDS
Gene -
Product TIGR03745 family integrating conjugative element membrane protein
Location 198596 - 198964 (strand: -1)
Length 369 (nucleotides) / 122 (amino acids)

Contig

Accession contig_3
Length 210665 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2637
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF11190 Protein of unknown function (DUF2976)

Protein Sequence

MDMKSFWGRGVRRIGASVVTLFTLFSLMPAYAALPSVEPPSSGGGGGLMDTIKGYLNDGIVIGGLVVAATAFIVVAIAAVTTFNEVRDQKAGWGKFGTIIVVGVVLIVAVVWLAGKSATIIF

Flanking regions ( +/- flanking 50bp)

GCCAGTTGAGTGTGCTGTTTAATTTATTTTACAGAATGAAAGGTCATTTTATGGATATGAAATCATTTTGGGGACGTGGTGTCCGTCGTATTGGTGCGTCAGTGGTGACGTTATTCACTTTATTCAGTCTGATGCCGGCGTATGCCGCACTGCCTTCGGTGGAACCCCCTTCTTCCGGTGGCGGCGGCGGACTGATGGACACCATTAAAGGCTATCTTAATGACGGCATTGTGATTGGCGGGCTGGTTGTGGCTGCGACGGCTTTTATCGTGGTGGCCATTGCCGCGGTCACCACGTTCAATGAAGTGCGCGACCAAAAGGCTGGCTGGGGTAAATTCGGTACAATTATTGTAGTCGGTGTCGTCCTGATTGTGGCGGTCGTCTGGCTGGCCGGAAAATCCGCCACTATTATTTTTTAAGCGGAGGCAACGATGCAGACCATCGATTTTATGCCGGATCGCTTAAATGC