Homologs in group_2648

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_06680 EHELCC_06680 100.0 Morganella morganii S2 ypjF Toxin YpjF
NLDBIP_07005 NLDBIP_07005 100.0 Morganella morganii S4 ypjF Toxin YpjF
LHKJJB_06540 LHKJJB_06540 100.0 Morganella morganii S3 ypjF Toxin YpjF
HKOGLL_04390 HKOGLL_04390 100.0 Morganella morganii S5 ypjF Toxin YpjF
PMI_RS12630 PMI_RS12630 100.0 Proteus mirabilis HI4320 - TA system toxin CbtA family protein

Distribution of the homologs in the orthogroup group_2648

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2648

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q46953 8.88e-11 57 38 1 77 1 ypjF Toxin YpjF Escherichia coli (strain K12)
P77692 7.18e-10 54 35 2 82 1 ykfI Toxin YkfI Escherichia coli (strain K12)
P64524 5.58e-08 50 47 0 51 1 cbtA Cytoskeleton-binding toxin CbtA Escherichia coli (strain K12)
P64525 5.58e-08 50 47 0 51 3 cbtA Toxin CbtA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_03855
Feature type CDS
Gene ypjF
Product Toxin YpjF
Location 175485 - 175784 (strand: -1)
Length 300 (nucleotides) / 99 (amino acids)
In genomic island -

Contig

Accession contig_3
Length 210665 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2648
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF06755 CbtA_toxin of type IV toxin-antitoxin system

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K18837 cytoskeleton-binding toxin CbtA and related proteins - -

Protein Sequence

MNKMTIIRFQLLVHQLLQVHYGITLSDTGLSDDAEVSRMIELGISPVSVVNRLVDKYHLDKLNASCYLPASPYVSDSDALLAQAQLSGAINPDVMPDNP

Flanking regions ( +/- flanking 50bp)

AGTTTTTACTGAATGAGGCCGCATCCCGACAGGCCGCGTAGGAGACTGCGATGAACAAAATGACCATTATCCGCTTTCAGTTACTGGTACATCAGTTACTGCAAGTGCATTACGGCATTACGCTGAGTGATACCGGATTGTCCGATGATGCTGAGGTGTCCCGGATGATTGAACTCGGGATATCGCCGGTATCGGTGGTCAACCGTCTGGTGGATAAGTACCACCTGGATAAACTGAATGCATCCTGTTATCTGCCGGCATCCCCGTATGTCAGTGACAGCGATGCCTTACTTGCACAGGCTCAGCTGAGCGGTGCCATTAACCCGGATGTCATGCCGGATAATCCTTAACGATTAACGACTGACATCTTTCCCGTGAGGGCTTGTTCCTCACGGGATAA