Homologs in group_694

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_03425 EHELCC_03425 100.0 Morganella morganii S2 - DUF1283 domain-containing protein
NLDBIP_00035 NLDBIP_00035 100.0 Morganella morganii S4 - DUF1283 domain-containing protein
LHKJJB_02000 LHKJJB_02000 100.0 Morganella morganii S3 - DUF1283 domain-containing protein
HKOGLL_02040 HKOGLL_02040 100.0 Morganella morganii S5 - DUF1283 domain-containing protein
F4V73_RS05395 F4V73_RS05395 87.6 Morganella psychrotolerans - DUF1283 family protein
PMI_RS06220 PMI_RS06220 45.8 Proteus mirabilis HI4320 - DUF1283 family protein

Distribution of the homologs in the orthogroup group_694

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_694

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N4T5 2.17e-40 133 55 3 118 3 plu2232 UPF0482 protein plu2232 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B2K4N0 1.15e-33 116 46 1 114 3 YPTS_2265 UPF0482 protein YPTS_2265/YPTS_2268 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q933A4 1.15e-33 116 46 1 114 3 YPTB2194 UPF0482 protein YPTB2194 Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FHW2 1.15e-33 116 46 1 114 3 YpsIP31758_1865 UPF0482 protein YpsIP31758_1865 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JKK5 1.35e-33 116 46 1 114 3 YPK_1977 UPF0482 protein YPK_1977 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A6T8U4 9.02e-33 114 49 2 118 3 KPN78578_15540 UPF0482 protein KPN78578_15540 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XR74 1.37e-32 113 49 2 118 3 KPK_2871 UPF0482 protein KPK_2871 Klebsiella pneumoniae (strain 342)
A1JMQ5 1.44e-32 113 47 1 114 3 YE2026 UPF0482 protein YE2026 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VEU3 4.77e-31 109 51 1 107 3 ETA_17520 UPF0482 protein ETA_17520 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B7LRA0 1.93e-30 108 50 1 104 3 ynfB UPF0482 protein YnfB Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A8GE49 2.1e-30 108 53 1 101 3 Spro_2288 UPF0482 protein Spro_2288 Serratia proteamaculans (strain 568)
Q1RBL6 8.88e-30 106 51 0 98 3 ynfB UPF0482 protein YnfB Escherichia coli (strain UTI89 / UPEC)
Q8CW20 8.88e-30 106 51 0 98 3 ynfB UPF0482 protein YnfB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0THP1 8.88e-30 106 51 0 98 3 ynfB UPF0482 protein YnfB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABC8 8.88e-30 106 51 0 98 3 ynfB UPF0482 protein YnfB Escherichia coli O1:K1 / APEC
B7MV29 8.88e-30 106 51 0 98 3 ynfB UPF0482 protein YnfB Escherichia coli O81 (strain ED1a)
B7M9T6 8.88e-30 106 51 0 98 3 ynfB UPF0482 protein YnfB Escherichia coli O45:K1 (strain S88 / ExPEC)
B7URS2 8.88e-30 106 51 0 98 3 ynfB UPF0482 protein YnfB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q7CQJ7 2.45e-29 105 48 2 118 3 ynfB UPF0482 protein YnfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEU2 2.45e-29 105 48 2 118 3 ynfB UPF0482 protein YnfB Salmonella typhi
B4TVH0 2.45e-29 105 48 2 118 3 ynfB UPF0482 protein YnfB Salmonella schwarzengrund (strain CVM19633)
B5BK73 2.45e-29 105 48 2 118 3 ynfB UPF0482 protein YnfB Salmonella paratyphi A (strain AKU_12601)
C0Q4W4 2.45e-29 105 48 2 118 3 ynfB UPF0482 protein YnfB Salmonella paratyphi C (strain RKS4594)
A9MZX0 2.45e-29 105 48 2 118 3 ynfB UPF0482 protein YnfB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PHH7 2.45e-29 105 48 2 118 3 ynfB UPF0482 protein YnfB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T5E0 2.45e-29 105 48 2 118 3 ynfB UPF0482 protein YnfB Salmonella newport (strain SL254)
B4THT5 2.45e-29 105 48 2 118 3 ynfB UPF0482 protein YnfB Salmonella heidelberg (strain SL476)
B5RAG2 2.45e-29 105 48 2 118 3 ynfB UPF0482 protein YnfB Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QUC3 2.45e-29 105 48 2 118 3 ynfB UPF0482 protein YnfB Salmonella enteritidis PT4 (strain P125109)
B5FHQ0 2.45e-29 105 48 2 118 3 ynfB UPF0482 protein YnfB Salmonella dublin (strain CT_02021853)
Q57PD5 2.45e-29 105 48 2 118 3 ynfB UPF0482 protein YnfB Salmonella choleraesuis (strain SC-B67)
B5F6E2 2.45e-29 105 48 2 118 3 ynfB UPF0482 protein YnfB Salmonella agona (strain SL483)
Q83L09 3.48e-29 104 49 0 99 3 ynfB UPF0482 protein YnfB Shigella flexneri
Q0T4M6 3.48e-29 104 49 0 99 3 ynfB UPF0482 protein YnfB Shigella flexneri serotype 5b (strain 8401)
B1LEV3 3.48e-29 104 49 0 99 3 ynfB UPF0482 protein YnfB Escherichia coli (strain SMS-3-5 / SECEC)
B7NB33 3.48e-29 104 49 0 99 3 ynfB UPF0482 protein YnfB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NUQ6 3.48e-29 104 49 0 99 3 ynfB UPF0482 protein YnfB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7L5D5 3.48e-29 104 49 0 99 3 ynfB UPF0482 protein YnfB Escherichia coli (strain 55989 / EAEC)
A7ZM42 3.48e-29 104 49 0 99 3 ynfB UPF0482 protein YnfB Escherichia coli O139:H28 (strain E24377A / ETEC)
A9MRN3 6.07e-29 104 49 2 117 3 ynfB UPF0482 protein YnfB Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8AGU6 7.47e-29 103 46 1 117 3 CKO_01577 UPF0482 protein CKO_01577 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q32G47 2.08e-28 102 48 0 99 3 ynfB UPF0482 protein YnfB Shigella dysenteriae serotype 1 (strain Sd197)
B6IB17 2.83e-28 102 48 0 99 3 ynfB UPF0482 protein YnfB Escherichia coli (strain SE11)
P76170 2.83e-28 102 48 0 99 1 ynfB UPF0482 protein YnfB Escherichia coli (strain K12)
B1IR07 2.83e-28 102 48 0 99 3 ynfB UPF0482 protein YnfB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0C3 2.83e-28 102 48 0 99 3 ynfB UPF0482 protein YnfB Escherichia coli O9:H4 (strain HS)
B1XF48 2.83e-28 102 48 0 99 3 ynfB UPF0482 protein YnfB Escherichia coli (strain K12 / DH10B)
C4ZWZ5 2.83e-28 102 48 0 99 3 ynfB UPF0482 protein YnfB Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZX5 2.83e-28 102 48 0 99 3 ynfB UPF0482 protein YnfB Escherichia coli O8 (strain IAI1)
B5Z418 6.92e-28 101 48 0 99 3 ynfB UPF0482 protein YnfB Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X7A0 6.92e-28 101 48 0 99 3 ynfB UPF0482 protein YnfB Escherichia coli O157:H7
A7MEI2 8.76e-28 101 59 0 79 3 ESA_01750 UPF0482 protein ESA_01750 Cronobacter sakazakii (strain ATCC BAA-894)
A4WA76 5.17e-27 99 57 0 82 3 Ent638_1930 UPF0482 protein Ent638_1930 Enterobacter sp. (strain 638)
Q6D4Y7 3.65e-26 97 58 0 79 3 ECA2253 UPF0482 protein ECA2253 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DH41 5.07e-26 97 58 0 79 3 PC1_2049 UPF0482 protein PC1_2049 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q2NSY2 1.01e-23 90 55 0 78 3 SG1468 UPF0482 protein SG1468 Sodalis glossinidius (strain morsitans)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_02955
Feature type CDS
Gene -
Product DUF1283 domain-containing protein
Location 285723 - 286088 (strand: 1)
Length 366 (nucleotides) / 121 (amino acids)

Contig

Accession contig_2
Length 292399 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_694
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06932 Protein of unknown function (DUF1283)

Protein Sequence

MTNSMLKKWFIATAFAAPFMFAAHAGAATTNCSPGSTCVISGGDTALEKERARQEKEQWDDTRSLRQKINRRAEKEFDKVDRAIDAEDACLKSSVVTAYWEPNTLRCLDANTGREVSTGWK

Flanking regions ( +/- flanking 50bp)

TCACGATCAGAATGACGTTTGCAGGTTTGAACTTTGAGGAAAACACGACAATGACTAACTCCATGCTCAAAAAGTGGTTTATCGCGACCGCCTTTGCTGCACCTTTCATGTTTGCAGCTCATGCAGGCGCGGCCACCACCAATTGCAGCCCCGGCAGCACTTGTGTGATCAGCGGCGGCGATACTGCGCTTGAAAAAGAGAGAGCACGCCAGGAAAAAGAGCAATGGGATGATACCCGTTCCCTGCGTCAGAAGATCAACCGCCGTGCGGAAAAAGAGTTCGACAAAGTTGACCGTGCTATTGATGCTGAAGATGCATGTTTAAAAAGCTCGGTTGTTACCGCGTATTGGGAACCTAATACGCTGCGCTGCCTTGATGCAAATACAGGGCGTGAAGTTTCCACTGGCTGGAAATAAATATATTTAAGGATAAATAATGAAAAAACTGATTGCGCTCAGTGCTGTTC