Homologs in group_2598

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_03220 EHELCC_03220 100.0 Morganella morganii S2 gloA Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family
NLDBIP_00240 NLDBIP_00240 100.0 Morganella morganii S4 gloA Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family
LHKJJB_01795 LHKJJB_01795 100.0 Morganella morganii S3 gloA Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family
HKOGLL_01835 HKOGLL_01835 100.0 Morganella morganii S5 gloA Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family
PMI_RS06005 PMI_RS06005 62.2 Proteus mirabilis HI4320 - VOC family protein

Distribution of the homologs in the orthogroup group_2598

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2598

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q502D1 6.45e-53 167 62 0 123 2 glod5 Glyoxalase domain-containing protein 5 Danio rerio
Q8ZM36 3.72e-49 157 57 0 123 1 STM3117 Virulence protein STM3117 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0C5H0 1.59e-47 152 55 0 121 2 GLOD5 Glyoxalase domain-containing protein 5 Canis lupus familiaris
Q54L71 1.6e-47 152 60 2 124 3 glod5 Glyoxalase domain-containing protein 5 homolog Dictyostelium discoideum
Q28CR0 1.78e-46 150 59 0 121 2 glod5 Glyoxalase domain-containing protein 5 Xenopus tropicalis
A6NK44 3.39e-46 150 53 0 126 1 GLOD5 Glyoxalase domain-containing protein 5 Homo sapiens
Q9D8I3 5.33e-46 149 53 0 126 1 Glod5 Glyoxalase domain-containing protein 5 Mus musculus
Q4KLB0 2.2e-44 145 57 0 121 2 glod5 Glyoxalase domain-containing protein 5 Xenopus laevis
A0A0U2WCB2 1.51e-41 138 55 1 123 3 RDO1 Glyoxalase domain-containing protein RDO1 Ustilago maydis
O07918 2.9e-06 46 30 4 119 3 yraH Uncharacterized protein YraH Bacillus subtilis (strain 168)
Q8CXK5 0.000132 42 27 3 123 3 fosB Metallothiol transferase FosB Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_02750
Feature type CDS
Gene gloA
Product Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family
Location 246798 - 247196 (strand: -1)
Length 399 (nucleotides) / 132 (amino acids)
In genomic island -

Contig

Accession contig_2
Length 292399 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2598
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00903 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0346 Secondary metabolites biosynthesis, transport and catabolism (Q) Q Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family

Protein Sequence

MITISHLDHLVLTVADVEKTCDFYRRVLGFSVITFRGDRRALVFGRQKINLHQAGNEFLPNADKPVPGSADLCFLTGTPVEQTLAHLAKEKIVVEEGPVERTGATGPIISVYFRDPDLNLIEIGLPVTSRPV

Flanking regions ( +/- flanking 50bp)

AATGTGATACCACGTAATGTACGAATAACAGCGATACAGGGAGTTGTCTGATGATTACAATTTCACACCTTGACCATCTGGTTCTGACGGTGGCCGATGTTGAAAAAACCTGTGATTTTTACCGTCGCGTACTGGGGTTTTCGGTCATTACGTTTCGCGGGGATCGCAGGGCTTTAGTGTTTGGCCGCCAGAAAATTAACTTGCATCAGGCAGGAAATGAATTTCTGCCGAATGCGGATAAACCGGTACCCGGTTCAGCAGATCTCTGTTTTCTCACCGGGACCCCGGTTGAACAGACGCTGGCGCATCTGGCAAAAGAAAAAATTGTTGTGGAAGAGGGGCCGGTGGAACGCACGGGGGCAACCGGCCCGATAATATCAGTCTATTTCCGTGACCCGGATTTAAACCTGATCGAGATTGGCCTGCCGGTGACGTCCCGGCCGGTATAAGCGGATAACAAAACCGCAAATCAATATCAGCACTATTGCAGCACAGATGA