Homologs in group_2526

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_02765 EHELCC_02765 100.0 Morganella morganii S2 fepD ABC-type Fe3+-siderophore transport system, permease component
NLDBIP_00695 NLDBIP_00695 100.0 Morganella morganii S4 fepD ABC-type Fe3+-siderophore transport system, permease component
LHKJJB_01340 LHKJJB_01340 100.0 Morganella morganii S3 fepD ABC-type Fe3+-siderophore transport system, permease component
HKOGLL_01380 HKOGLL_01380 100.0 Morganella morganii S5 fepD ABC-type Fe3+-siderophore transport system, permease component
F4V73_RS04670 F4V73_RS04670 93.2 Morganella psychrotolerans - iron ABC transporter permease

Distribution of the homologs in the orthogroup group_2526

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2526

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q57130 1.09e-83 259 44 1 324 1 molB Molybdate import system permease protein MolB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q57552 3.5e-54 184 36 7 338 3 MJ0087 Putative ABC transporter permease protein MJ0087 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O34451 1.01e-53 183 37 7 336 3 yvrB Uncharacterized ABC transporter permease protein YvrB Bacillus subtilis (strain 168)
Q56992 1.48e-49 171 39 8 289 1 hmuU Hemin transport system permease protein HmuU Yersinia pestis
O05731 1.72e-48 168 41 6 270 3 HP_0889 Probable iron chelatin transport system permease protein HP_0889 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZKW2 9.64e-47 164 41 6 270 3 jhp_0822 Probable iron chelatin transport system permease protein jhp_0822 Helicobacter pylori (strain J99 / ATCC 700824)
Q9HQ19 6.42e-44 157 39 3 284 1 btuC Cobalamin import system permease protein BtuC Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G3 6.42e-44 157 39 3 284 3 btuC Cobalamin import system permease protein BtuC Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q81L64 6.81e-44 163 37 10 331 1 fpuB Petrobactin import system permease protein FpuB Bacillus anthracis
Q81L64 1.23e-26 114 30 6 304 1 fpuB Petrobactin import system permease protein FpuB Bacillus anthracis
A8AHA4 1.48e-42 153 35 6 314 3 btuC Vitamin B12 import system permease protein BtuC Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q9KSL2 3.11e-42 152 35 8 334 3 btuC Vitamin B12 import system permease protein BtuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A9MFB6 4.57e-42 152 38 6 289 3 btuC Vitamin B12 import system permease protein BtuC Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6TAH6 4.64e-42 152 34 6 291 3 btuC Vitamin B12 import system permease protein BtuC Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q32FI8 7.65e-41 148 36 5 291 3 btuC Vitamin B12 import system permease protein BtuC Shigella dysenteriae serotype 1 (strain Sd197)
B5BA35 1.67e-40 147 38 6 289 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi A (strain AKU_12601)
Q5PH87 1.67e-40 147 38 6 289 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZPS8 2.01e-40 147 38 6 289 3 btuC Vitamin B12 import system permease protein BtuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TUF7 2.01e-40 147 38 6 289 3 btuC Vitamin B12 import system permease protein BtuC Salmonella schwarzengrund (strain CVM19633)
A9N235 2.01e-40 147 38 6 289 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TGH8 2.01e-40 147 38 6 289 3 btuC Vitamin B12 import system permease protein BtuC Salmonella heidelberg (strain SL476)
B5FJA1 2.01e-40 147 38 6 289 3 btuC Vitamin B12 import system permease protein BtuC Salmonella dublin (strain CT_02021853)
B5F7F5 2.01e-40 147 38 6 289 3 btuC Vitamin B12 import system permease protein BtuC Salmonella agona (strain SL483)
Q8Z6I5 2.46e-40 147 37 6 289 3 btuC Vitamin B12 import system permease protein BtuC Salmonella typhi
Q57PU6 2.73e-40 147 37 6 289 3 btuC Vitamin B12 import system permease protein BtuC Salmonella choleraesuis (strain SC-B67)
P40411 2.96e-40 147 30 5 338 1 feuC Iron-uptake system permease protein FeuC Bacillus subtilis (strain 168)
B4T4N5 3.52e-40 147 37 6 289 3 btuC Vitamin B12 import system permease protein BtuC Salmonella newport (strain SL254)
B5RAW6 3.52e-40 147 37 6 289 3 btuC Vitamin B12 import system permease protein BtuC Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVW1 3.52e-40 147 37 6 289 3 btuC Vitamin B12 import system permease protein BtuC Salmonella enteritidis PT4 (strain P125109)
P15029 1.3e-38 142 39 7 281 1 fecD Fe(3+) dicitrate transport system permease protein FecD Escherichia coli (strain K12)
Q3Z259 2.89e-38 141 35 5 291 3 btuC Vitamin B12 import system permease protein BtuC Shigella sonnei (strain Ss046)
P49937 1.13e-37 140 31 7 331 3 fhuG Iron(3+)-hydroxamate import system permease protein FhuG Bacillus subtilis (strain 168)
Q6LQ76 1.54e-37 140 38 7 285 3 btuC Vitamin B12 import system permease protein BtuC Photobacterium profundum (strain SS9)
O31569 3.25e-37 139 35 7 294 1 yfhA Probable siderophore transport system permease protein YfhA Bacillus subtilis (strain 168)
B7M1C0 4.87e-36 135 35 5 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O8 (strain IAI1)
A7ZMH9 4.87e-36 135 35 5 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O139:H28 (strain E24377A / ETEC)
A1JPQ9 5.04e-36 136 35 8 292 3 btuC Vitamin B12 import system permease protein BtuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B7L6I4 5.52e-36 135 35 5 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain 55989 / EAEC)
Q0T4S1 6.32e-36 135 36 5 286 3 btuC Vitamin B12 import system permease protein BtuC Shigella flexneri serotype 5b (strain 8401)
B6I8R6 1.27e-35 134 35 5 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain SE11)
B1IPL6 1.57e-35 134 35 5 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0Q3 1.57e-35 134 35 5 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O9:H4 (strain HS)
B1JJ25 1.59e-35 134 31 9 329 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669Z9 1.59e-35 134 31 9 329 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype I (strain IP32953)
A9R099 1.59e-35 134 31 9 329 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDX4 1.59e-35 134 31 9 329 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pestis
B2K660 1.59e-35 134 31 9 329 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FHG9 1.59e-35 134 31 9 329 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7C1M5 1.74e-35 134 35 5 291 3 btuC Vitamin B12 import system permease protein BtuC Shigella flexneri
B7US50 1.79e-35 134 35 5 290 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q1RB84 1.99e-35 134 35 5 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain UTI89 / UPEC)
B1LE19 1.99e-35 134 35 5 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain SMS-3-5 / SECEC)
P06609 1.99e-35 134 35 5 291 1 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12)
A1ABP7 1.99e-35 134 35 5 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O1:K1 / APEC
B1XG18 1.99e-35 134 35 5 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12 / DH10B)
C4ZYH3 1.99e-35 134 35 5 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12 / MC4100 / BW2952)
B7NT65 1.99e-35 134 35 5 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MAS2 1.99e-35 134 35 5 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O45:K1 (strain S88 / ExPEC)
A8GDR2 2.59e-35 134 33 4 285 3 btuC Vitamin B12 import system permease protein BtuC Serratia proteamaculans (strain 568)
B7MVJ0 2.66e-35 134 35 5 290 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O81 (strain ED1a)
Q0THB7 2.84e-35 134 35 5 290 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B5YPZ9 3.32e-35 133 36 5 286 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4L7 3.32e-35 133 36 5 286 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O157:H7
B7LQ78 3.46e-35 133 33 8 334 3 btuC Vitamin B12 import system permease protein BtuC Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
O34832 3.54e-35 134 38 6 289 3 yfmE Fe(3+)-citrate import system permease protein YfmE Bacillus subtilis (strain 168)
B7N549 6.95e-35 132 35 5 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FH26 7.79e-35 132 35 5 290 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O34933 7.88e-35 132 35 4 264 3 yfmD Fe(3+)-citrate import system permease protein YfmD Bacillus subtilis (strain 168)
B2U360 1.4e-34 132 34 7 314 3 btuC Vitamin B12 import system permease protein BtuC Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
O31568 1.52e-34 132 32 8 332 1 yfiZ Probable siderophore transport system permease protein YfiZ Bacillus subtilis (strain 168)
P49936 6.86e-34 131 35 6 292 3 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Bacillus subtilis (strain 168)
Q7MLE7 1.04e-33 129 35 7 275 3 btuC Vitamin B12 import system permease protein BtuC Vibrio vulnificus (strain YJ016)
Q7N3Q3 1.38e-33 129 34 8 292 3 btuC Vitamin B12 import system permease protein BtuC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8D927 1.46e-33 129 35 8 284 3 btuC Vitamin B12 import system permease protein BtuC Vibrio vulnificus (strain CMCP6)
Q321G8 4.53e-33 128 34 7 314 3 btuC Vitamin B12 import system permease protein BtuC Shigella boydii serotype 4 (strain Sb227)
Q47085 6.11e-32 125 38 4 275 3 cbrB Achromobactin transport system permease protein CbrB Dickeya dadantii (strain 3937)
P15030 4.04e-31 122 35 5 292 1 fecC Fe(3+) dicitrate transport system permease protein FecC Escherichia coli (strain K12)
Q6D656 2.06e-30 120 32 5 285 3 btuC Vitamin B12 import system permease protein BtuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P23876 4.87e-29 117 34 5 297 1 fepD Ferric enterobactin transport system permease protein FepD Escherichia coli (strain K12)
Q87Q39 1.59e-28 115 33 9 266 3 btuC Vitamin B12 import system permease protein BtuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P40410 1.84e-28 115 32 9 286 1 feuB Iron-uptake system permease protein FeuB Bacillus subtilis (strain 168)
Q2YX91 9.41e-26 108 31 6 286 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain bovine RF122 / ET3-1)
O87656 4.99e-25 109 32 4 277 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O87656 8.78e-13 72 27 6 279 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6GHV2 3.05e-23 101 31 6 286 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MRSA252)
Q7A651 3.05e-23 101 31 6 286 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain N315)
Q99UX0 3.05e-23 101 31 6 286 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QG35 3.05e-23 101 31 6 286 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Newman)
Q5HGV0 3.05e-23 101 31 6 286 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain COL)
Q2FHU7 3.05e-23 101 31 6 286 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain USA300)
A7X154 3.05e-23 101 31 6 286 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Mu3 / ATCC 700698)
P06972 6.32e-23 103 30 6 327 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Escherichia coli (strain K12)
P06972 1.87e-11 68 28 10 292 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Escherichia coli (strain K12)
Q8NX64 7.68e-23 100 31 6 286 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MW2)
Q6GA81 7.68e-23 100 31 6 286 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MSSA476)
P23877 1.04e-22 100 32 4 287 1 fepG Ferric enterobactin transport system permease protein FepG Escherichia coli (strain K12)
Q2FZE5 2.1e-20 93 31 7 286 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain NCTC 8325 / PS 47)
P37738 3.74e-20 92 30 6 272 1 fatD Ferric-anguibactin transport system permease protein FatD Vibrio anguillarum (strain ATCC 68554 / 775)
P94418 3.58e-18 87 27 8 290 1 yclN Petrobactin import system permease protein YclN Bacillus subtilis (strain 168)
Q58286 3.62e-18 87 25 11 342 3 MJ0876 Putative ABC transporter permease protein MJ0876 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q81XB1 8.7e-15 77 30 10 274 1 fatD Petrobactin import system permease protein FatD Bacillus anthracis
Q47086 1.12e-13 74 30 6 290 3 cbrC Achromobactin transport system permease protein CbrC Dickeya dadantii (strain 3937)
P94419 2.48e-11 67 23 3 279 1 yclO Petrobactin import system permease protein YclO Bacillus subtilis (strain 168)
Q58287 1.95e-05 47 32 1 81 3 MJ0877 Putative ABC transporter permease protein MJ0877 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_02295
Feature type CDS
Gene fepD
Product ABC-type Fe3+-siderophore transport system, permease component
Location 145850 - 146869 (strand: -1)
Length 1020 (nucleotides) / 339 (amino acids)

Contig

Accession contig_2
Length 292399 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2526
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01032 FecCD transport family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0609 Inorganic ion transport and metabolism (P) P ABC-type Fe3+-siderophore transport system, permease component

Protein Sequence

MCRSRLQWYLLSALLLLTIVLALCAGRYAVSVTTVLQILADTLTGRSPSAEYSRTAENVVLYVRLPRILIAGLAGAGLAVAGAALQGIFRNPLVGPQIIGVSSGAALGGALALLLFSSLFITISFAFLGGLLAIVLVFLLGLNRHGSSLLMLILAGVIINAFFAALISLITYFADPNNTLQTIVFWLMGSFATATYLKVSVLLPVVIIAGGIIFALRFRINVLSLGGENAQALGLPVTVTRWTILVCVTLITSATVAVSGTIGWVGLIIPHIARLISGHDHRVLLPASALTGAIYLIAVDTLARSMTSAEIPLSVITALIGAPIFALLIHSMNKKVADL

Flanking regions ( +/- flanking 50bp)

GATCTAAACCGGGAAGGCCGTGATTATCTGACACTGATGGGGCGGCCGTGATGTGCCGATCCCGCCTGCAATGGTACCTGTTATCCGCCCTGTTATTACTGACAATAGTGCTTGCGCTATGTGCCGGGCGCTATGCGGTCTCTGTGACAACGGTTCTGCAAATCCTGGCGGATACCCTGACCGGACGCAGCCCGTCTGCAGAATACAGCCGCACCGCTGAAAATGTGGTGCTGTATGTCCGTCTGCCGCGCATTCTGATCGCCGGACTGGCCGGCGCCGGACTGGCGGTTGCCGGTGCCGCATTACAGGGCATCTTCCGCAATCCGCTGGTGGGGCCGCAGATTATCGGTGTTTCATCCGGCGCAGCGCTGGGCGGCGCACTGGCCCTGCTGCTTTTCTCCTCTTTATTTATCACTATCAGTTTTGCCTTTCTCGGCGGTCTGCTGGCCATTGTGCTGGTCTTTCTGCTGGGGCTTAACCGGCACGGCAGCAGTCTTCTGATGCTGATCCTTGCGGGCGTGATTATTAATGCTTTTTTTGCCGCCCTGATTTCGCTGATCACCTATTTTGCGGATCCGAACAATACCCTGCAAACCATCGTGTTCTGGCTGATGGGCAGTTTTGCCACCGCAACCTATCTGAAAGTGAGCGTGTTACTGCCGGTTGTCATCATTGCAGGCGGGATTATTTTTGCCCTCCGCTTCCGCATCAATGTGCTGTCCCTCGGCGGGGAAAACGCACAGGCGCTGGGGCTGCCCGTCACCGTAACCCGCTGGACTATCCTGGTCTGCGTCACGCTGATCACCAGCGCCACCGTGGCCGTTTCCGGCACCATCGGTTGGGTCGGGCTGATTATTCCGCATATCGCGCGACTGATCAGCGGACATGACCACCGCGTTCTTCTGCCCGCCAGTGCCCTGACCGGCGCGATTTATCTGATCGCCGTCGATACCCTGGCGCGCAGTATGACCAGTGCGGAGATCCCGCTGAGTGTCATCACCGCACTGATCGGGGCACCGATTTTCGCCCTGCTCATTCACTCCATGAATAAAAAGGTGGCAGACCTGTGATCCGTGTTAATCAGCTCAGTTACCACACCGGCAAACGTCCGTTATTTGAC