Homologs in group_672

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_02270 EHELCC_02270 100.0 Morganella morganii S2 - DUF2474 domain-containing protein
NLDBIP_01190 NLDBIP_01190 100.0 Morganella morganii S4 - DUF2474 domain-containing protein
LHKJJB_00845 LHKJJB_00845 100.0 Morganella morganii S3 - DUF2474 domain-containing protein
HKOGLL_00885 HKOGLL_00885 100.0 Morganella morganii S5 - DUF2474 domain-containing protein
F4V73_RS04125 F4V73_RS04125 82.4 Morganella psychrotolerans - DUF2474 domain-containing protein
PMI_RS18980 PMI_RS18980 62.7 Proteus mirabilis HI4320 - DUF2474 domain-containing protein

Distribution of the homologs in the orthogroup group_672

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_672

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_01800
Feature type CDS
Gene -
Product DUF2474 domain-containing protein
Location 48130 - 48309 (strand: -1)
Length 180 (nucleotides) / 59 (amino acids)
In genomic island -

Contig

Accession contig_2
Length 292399 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_672
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF10617 Protein of unknown function (DUF2474)

Protein Sequence

MSSEEKSPMTRAITEPAAPAPWWKKAAWMVAIWAGSVLALFAVSSLFRLLMTAAGMKVR

Flanking regions ( +/- flanking 50bp)

CGCTTTATTCATCATACCGGTCATCCTGGTATATACCTGGTGGAGTTATTATGTCTTCAGAGGAAAAATCACCCATGACCAGGGCTATCACTGAACCTGCCGCACCGGCCCCCTGGTGGAAAAAAGCCGCCTGGATGGTCGCTATCTGGGCAGGCAGTGTTCTGGCACTGTTTGCAGTCTCATCACTTTTCCGCTTATTAATGACGGCGGCGGGAATGAAAGTAAGATAGTCGTCATGTCTCATCAGTAAGTACCTCATCAGTACATCATGCACTGTGTA