Homologs in group_577

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_00585 EHELCC_00585 100.0 Morganella morganii S2 - DUF2526 domain-containing protein
NLDBIP_02875 NLDBIP_02875 100.0 Morganella morganii S4 - DUF2526 domain-containing protein
LHKJJB_04390 LHKJJB_04390 100.0 Morganella morganii S3 - DUF2526 domain-containing protein
HKOGLL_02655 HKOGLL_02655 100.0 Morganella morganii S5 - DUF2526 domain-containing protein
F4V73_RS07040 F4V73_RS07040 88.3 Morganella psychrotolerans - DUF2526 family protein
PMI_RS00800 PMI_RS00800 48.3 Proteus mirabilis HI4320 - DUF2526 family protein

Distribution of the homologs in the orthogroup group_577

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_577

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64458 5.23e-11 55 47 0 59 4 ydcY Uncharacterized protein YdcY Shigella flexneri
P64455 5.23e-11 55 47 0 59 1 ydcY Uncharacterized protein YdcY Escherichia coli (strain K12)
P64456 5.23e-11 55 47 0 59 4 ydcY Uncharacterized protein YdcY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P64457 5.23e-11 55 47 0 59 4 ydcY Uncharacterized protein YdcY Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_00960
Feature type CDS
Gene -
Product DUF2526 domain-containing protein
Location 175425 - 175607 (strand: 1)
Length 183 (nucleotides) / 60 (amino acids)
In genomic island -

Contig

Accession contig_1
Length 309072 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_577
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF10735 Protein of unknown function (DUF2526)

Protein Sequence

MSDYAQSVADVEKAIESNSITEMNELMVSLGDSNPLPYEQRYELQQRLRQAIMDHGKIHH

Flanking regions ( +/- flanking 50bp)

TGTTCAGGTAGGATAACCGCATTATTATCAGACTGAATAAGGACAGCCGTATGAGCGATTATGCACAGAGTGTTGCTGATGTGGAAAAAGCCATTGAGAGTAACAGTATCACTGAAATGAACGAACTGATGGTCAGCCTGGGTGACAGCAACCCGCTGCCGTATGAACAGCGTTATGAATTACAGCAGCGCCTCCGCCAGGCGATAATGGATCACGGAAAAATACATCACTAGTTAATTCTTATTCCGTACCGGCTTATTACCAGAATAATATACCGGTACGG