Homologs in group_3161

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_01210 EHELCC_01210 100.0 Morganella morganii S2 - Secreted protein
NLDBIP_02250 NLDBIP_02250 100.0 Morganella morganii S4 - Secreted protein
LHKJJB_03765 LHKJJB_03765 100.0 Morganella morganii S3 - Secreted protein
HKOGLL_03280 HKOGLL_03280 100.0 Morganella morganii S5 - Secreted protein

Distribution of the homologs in the orthogroup group_3161

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3161

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_00335
Feature type CDS
Gene -
Product Secreted protein
Location 44433 - 44597 (strand: 1)
Length 165 (nucleotides) / 54 (amino acids)
In genomic island -

Contig

Accession contig_1
Length 309072 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3161
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MTIGFVLLLVMHGSAVPVTDDIYTLEECESRAVQVMTVRNVELVCAEVVREQRN

Flanking regions ( +/- flanking 50bp)

CAGTTTAACAAATTATCAACCATCCCACTCTACCGCCTAGACAAACAACCATGACAATCGGATTTGTATTACTACTGGTAATGCACGGCTCTGCTGTGCCTGTTACCGATGATATTTATACGCTCGAAGAATGTGAGAGCCGCGCAGTGCAGGTAATGACTGTGCGGAATGTTGAATTAGTGTGTGCGGAGGTGGTTCGTGAGCAGAGAAATTAAAGTAAGTTCAGGTGCATTTCAGTGCGATTTAGAAATTACCTTTCGCGTTA