Homologs in group_3723
2 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| PMI_RS10295 | PMI_RS10295 | 46.6 | Proteus mirabilis HI4320 | - | DNA-binding protein |
| PMI_RS18695 | PMI_RS18695 | 33.3 | Proteus mirabilis HI4320 | - | putative addiction module antidote protein |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|
| Source | Morganella psychrotolerans |
|---|---|
| Locus tag | F4V73_RS19295 |
| Feature type | CDS |
| Gene | - |
| Product | hypothetical protein |
| Location | 453677 - 453853 (strand: -1) |
| Length | 177 (nucleotides) / 58 (amino acids) |
| Accession | term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object |
|---|---|
| Length | 2012992 nucleotides |
| Topology | linear |
| Plasmid | False |
| Orthogroup | group_3723 | |
|---|---|---|
| Orthogroup size | 3 | |
| N. genomes | 2 |
| ID | Function(s) descr. | Function(s) cat. | Description |
|---|---|---|---|
| COG3636 | Mobilome: prophages, transposons (X) | X | Uncharacterized Zn-binding protein, DUF971 domain |
MTKSRLYDDSMIEILRDDPEFSTAYLYQAFLDIDEDGGLGAFWIALCHIIEAHNHTSQ
GGTTCACGGAACACTGTCCGCTGTTTAAAAATGATTTGCAAAGGTGATATATGACTAAATCCCGTTTGTACGATGATTCCATGATCGAAATCCTGCGGGATGATCCCGAGTTTTCTACTGCCTATCTGTATCAGGCTTTTCTTGATATAGATGAGGATGGTGGCTTGGGGGCATTTTGGATAGCACTTTGTCATATCATTGAAGCTCACAATCATACATCCCAGTAACCGGATGATATATTCAGCATATCCTTTACCATATTTGGAGGTTTTATTGG
