Homologs in group_4278

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4278

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4278

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A0A140ND86 9.34e-13 60 38 1 86 1 dinJ Antitoxin DinJ Escherichia coli (strain B / BL21-DE3)
Q47150 1.08e-12 60 38 1 86 1 dinJ Antitoxin DinJ Escherichia coli (strain K12)
P71357 4.38e-07 46 31 1 74 3 relB Putative antitoxin RelB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0C080 0.000253 39 36 0 44 3 relB Antitoxin RelB Shigella flexneri
P0C079 0.000253 39 36 0 44 1 relB Antitoxin RelB Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS19200
Feature type CDS
Gene -
Product type II toxin-antitoxin system RelB/DinJ family antitoxin
Location 4338 - 4595 (strand: 1)
Length 258 (nucleotides) / 85 (amino acids)

Contig

Accession term accessions NZ_VXKB01000013 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 5246 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_4278
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF04221 RelB antitoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3077 Defense mechanisms (V) V Antitoxin component of the RelBE or YafQ-DinJ toxin-antitoxin module

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07473 DNA-damage-inducible protein J - -

Protein Sequence

MIADATVKARIPQDVKDRAVQALEKIGLNTSDVIRMVMMRVADEGKLPFEVKTPNKKTQIAMSELDSGKGQRFDSVDALFDDLGI

Flanking regions ( +/- flanking 50bp)

TAATTCAACGGGAGTTTTGGTATTAACTCCTGATTATTTAGGAGGTTATTATGATCGCTGACGCAACTGTTAAAGCCCGAATCCCGCAGGATGTTAAAGACCGTGCAGTACAGGCACTTGAAAAGATAGGACTGAATACTTCCGATGTGATCCGTATGGTTATGATGCGTGTTGCTGACGAGGGTAAACTTCCTTTTGAGGTAAAAACCCCGAATAAAAAAACGCAAATCGCCATGTCTGAATTAGATTCAGGAAAAGGTCAGCGTTTTGATTCAGTTGATGCTCTTTTTGATGATTTGGGTATCTGATGCTTATTCCTGTACAGTCCAGTGCCTTTAAGTCGGATGTAAAGAGACAA