Homologs in group_2395

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19225 FBDBKF_19225 98.9 Morganella morganii S1 rpsS 30S ribosomal protein S19
EHELCC_18970 EHELCC_18970 98.9 Morganella morganii S2 rpsS 30S ribosomal protein S19
NLDBIP_18985 NLDBIP_18985 98.9 Morganella morganii S4 rpsS 30S ribosomal protein S19
LHKJJB_18840 LHKJJB_18840 98.9 Morganella morganii S3 rpsS 30S ribosomal protein S19
HKOGLL_18575 HKOGLL_18575 98.9 Morganella morganii S5 rpsS 30S ribosomal protein S19
PMI_RS16170 PMI_RS16170 97.8 Proteus mirabilis HI4320 rpsS 30S ribosomal protein S19

Distribution of the homologs in the orthogroup group_2395

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2395

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1I8 1.92e-62 187 97 0 92 3 rpsS Small ribosomal subunit protein uS19 Proteus mirabilis (strain HI4320)
Q7MYF5 2.3e-61 184 94 0 92 3 rpsS Small ribosomal subunit protein uS19 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DG70 9.69e-61 182 93 0 92 3 rpsS Small ribosomal subunit protein uS19 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZX4 9.69e-61 182 93 0 92 3 rpsS Small ribosomal subunit protein uS19 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1JIW5 1.04e-60 182 92 0 92 3 rpsS Small ribosomal subunit protein uS19 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
P11256 1.04e-60 182 92 0 92 3 rpsS Small ribosomal subunit protein uS19 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGZ6 1.04e-60 182 92 0 92 3 rpsS Small ribosomal subunit protein uS19 Yersinia pestis (strain Pestoides F)
Q1CCU8 1.04e-60 182 92 0 92 3 rpsS Small ribosomal subunit protein uS19 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R900 1.04e-60 182 92 0 92 3 rpsS Small ribosomal subunit protein uS19 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJA8 1.04e-60 182 92 0 92 3 rpsS Small ribosomal subunit protein uS19 Yersinia pestis
B2K5M6 1.04e-60 182 92 0 92 3 rpsS Small ribosomal subunit protein uS19 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2V1 1.04e-60 182 92 0 92 3 rpsS Small ribosomal subunit protein uS19 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNN1 1.04e-60 182 92 0 92 3 rpsS Small ribosomal subunit protein uS19 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JS33 1.04e-60 182 92 0 92 3 rpsS Small ribosomal subunit protein uS19 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VK60 2.39e-60 181 92 0 92 3 rpsS Small ribosomal subunit protein uS19 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NQM6 8.07e-60 180 92 0 92 3 rpsS Small ribosomal subunit protein uS19 Sodalis glossinidius (strain morsitans)
A4ST02 2.32e-59 179 92 0 92 3 rpsS Small ribosomal subunit protein uS19 Aeromonas salmonicida (strain A449)
A0KF25 2.32e-59 179 92 0 92 3 rpsS Small ribosomal subunit protein uS19 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q87T09 7.42e-59 177 91 0 92 3 rpsS Small ribosomal subunit protein uS19 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P67900 1.26e-58 177 91 0 91 3 rpsS Small ribosomal subunit protein uS19 Pasteurella multocida (strain Pm70)
Q65QV9 1.26e-58 177 91 0 91 3 rpsS Small ribosomal subunit protein uS19 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0UX17 1.26e-58 177 91 0 91 3 rpsS Small ribosomal subunit protein uS19 Histophilus somni (strain 2336)
Q0I159 1.26e-58 177 91 0 91 3 rpsS Small ribosomal subunit protein uS19 Histophilus somni (strain 129Pt)
P67899 1.26e-58 177 91 0 91 3 rpsS Small ribosomal subunit protein uS19 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHT4 1.26e-58 177 91 0 91 3 rpsS Small ribosomal subunit protein uS19 Haemophilus influenzae (strain PittGG)
A5UDU3 1.26e-58 177 91 0 91 3 rpsS Small ribosomal subunit protein uS19 Haemophilus influenzae (strain PittEE)
Q4QMB8 1.26e-58 177 91 0 91 3 rpsS Small ribosomal subunit protein uS19 Haemophilus influenzae (strain 86-028NP)
P67898 1.26e-58 177 91 0 91 3 rpsS Small ribosomal subunit protein uS19 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B8F759 1.26e-58 177 91 0 91 3 rpsS Small ribosomal subunit protein uS19 Glaesserella parasuis serovar 5 (strain SH0165)
P67897 1.26e-58 177 91 0 91 3 rpsS Small ribosomal subunit protein uS19 Aggregatibacter actinomycetemcomitans
A6VLJ2 1.26e-58 177 91 0 91 3 rpsS Small ribosomal subunit protein uS19 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0BST5 1.26e-58 177 91 0 91 3 rpsS Small ribosomal subunit protein uS19 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ15 1.26e-58 177 91 0 91 3 rpsS Small ribosomal subunit protein uS19 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N362 1.26e-58 177 91 0 91 3 rpsS Small ribosomal subunit protein uS19 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B1KMX9 1.78e-58 177 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella woodyi (strain ATCC 51908 / MS32)
A1REB8 1.78e-58 177 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella sp. (strain W3-18-1)
Q0I0A1 1.78e-58 177 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella sp. (strain MR-7)
Q0HNT3 1.78e-58 177 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella sp. (strain MR-4)
A8G1E4 1.78e-58 177 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella sediminis (strain HAW-EB3)
A0KRM8 1.78e-58 177 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella sp. (strain ANA-3)
B8CND7 1.78e-58 177 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella piezotolerans (strain WP3 / JCM 13877)
A4YBX9 1.78e-58 177 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EK64 1.78e-58 177 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q089Q0 1.78e-58 177 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella frigidimarina (strain NCIMB 400)
Q12SV5 1.78e-58 177 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A9KWA6 1.78e-58 177 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella baltica (strain OS195)
A6WHT2 1.78e-58 177 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella baltica (strain OS185)
A3DA68 1.78e-58 177 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBK1 1.78e-58 177 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella baltica (strain OS223)
A8GYY0 3.34e-58 176 88 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A3Q986 3.34e-58 176 88 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B0TM08 3.34e-58 176 88 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella halifaxensis (strain HAW-EB4)
A7MWI7 3.53e-58 176 90 0 92 3 rpsS Small ribosomal subunit protein uS19 Vibrio campbellii (strain ATCC BAA-1116)
Q6LVB2 4.25e-58 176 90 0 92 3 rpsS Small ribosomal subunit protein uS19 Photobacterium profundum (strain SS9)
A1S222 4.39e-58 176 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q7MPI4 5.59e-58 175 90 0 92 3 rpsS Small ribosomal subunit protein uS19 Vibrio vulnificus (strain YJ016)
Q8DE43 5.59e-58 175 90 0 92 3 rpsS Small ribosomal subunit protein uS19 Vibrio vulnificus (strain CMCP6)
Q5QXY1 1.55e-57 174 88 0 92 3 rpsS Small ribosomal subunit protein uS19 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q487Z7 2.55e-57 174 90 0 91 3 rpsS Small ribosomal subunit protein uS19 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B5FG13 5.31e-57 173 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Aliivibrio fischeri (strain MJ11)
Q5E8B1 5.31e-57 173 89 0 92 3 rpsS Small ribosomal subunit protein uS19 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q1LTD4 6.69e-57 172 86 0 91 3 rpsS Small ribosomal subunit protein uS19 Baumannia cicadellinicola subsp. Homalodisca coagulata
B6EPS9 7.22e-57 172 88 0 92 3 rpsS Small ribosomal subunit protein uS19 Aliivibrio salmonicida (strain LFI1238)
A1T0D8 1.43e-56 172 88 0 92 3 rpsS Small ribosomal subunit protein uS19 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q15YN5 1.9e-56 171 89 0 91 3 rpsS Small ribosomal subunit protein uS19 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q3YWU3 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Shigella sonnei (strain Ss046)
P0A7U6 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Shigella flexneri
Q32B35 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VW0 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Shigella boydii serotype 4 (strain Sb227)
B2U2T4 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LRT2 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R609 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli (strain UTI89 / UPEC)
B1LHD0 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli (strain SMS-3-5 / SECEC)
B6I230 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli (strain SE11)
B7NDT7 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7U3 6.49e-56 170 96 0 83 1 rpsS Small ribosomal subunit protein uS19 Escherichia coli (strain K12)
B1IPY3 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7U4 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCE5 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGK4 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli O1:K1 / APEC
A8A5C1 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli O9:H4 (strain HS)
B1X6G7 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli (strain K12 / DH10B)
C4ZUH1 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1N0 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli O8 (strain IAI1)
B7N1A0 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli O81 (strain ED1a)
B7NLN5 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTN7 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7U5 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli O157:H7
B7L4K5 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli (strain 55989 / EAEC)
B7MCT1 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK40 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSK5 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AQL3 6.49e-56 170 96 0 83 3 rpsS Small ribosomal subunit protein uS19 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q2S916 1.27e-55 169 87 0 91 3 rpsS Small ribosomal subunit protein uS19 Hahella chejuensis (strain KCTC 2396)
P66491 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66492 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Salmonella typhi
B4TXD8 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Salmonella schwarzengrund (strain CVM19633)
B5BGY2 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Salmonella paratyphi A (strain AKU_12601)
C0Q0B2 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Salmonella paratyphi C (strain RKS4594)
A9MSZ4 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIV6 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUT6 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Salmonella newport (strain SL254)
B4TKL1 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Salmonella heidelberg (strain SL476)
B5RH19 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R287 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Salmonella enteritidis PT4 (strain P125109)
B5FJL0 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Salmonella dublin (strain CT_02021853)
Q57J36 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Salmonella choleraesuis (strain SC-B67)
A9MN52 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F8E8 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Salmonella agona (strain SL483)
A6TEW8 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XN98 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Klebsiella pneumoniae (strain 342)
A4WFC4 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Enterobacter sp. (strain 638)
A7MPI3 1.8e-55 169 95 0 83 3 rpsS Small ribosomal subunit protein uS19 Cronobacter sakazakii (strain ATCC BAA-894)
Q493K4 6.01e-55 168 82 0 91 3 rpsS Small ribosomal subunit protein uS19 Blochmanniella pennsylvanica (strain BPEN)
A1TYK1 7.28e-55 167 83 0 91 3 rpsS Small ribosomal subunit protein uS19 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A6W388 1.5e-54 167 84 0 91 3 rpsS Small ribosomal subunit protein uS19 Marinomonas sp. (strain MWYL1)
Q1R0H1 2.81e-54 166 84 0 91 3 rpsS Small ribosomal subunit protein uS19 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
C3LRQ4 1.06e-53 164 92 0 83 3 rpsS Small ribosomal subunit protein uS19 Vibrio cholerae serotype O1 (strain M66-2)
Q9KNY8 1.06e-53 164 92 0 83 3 rpsS Small ribosomal subunit protein uS19 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F545 1.06e-53 164 92 0 83 3 rpsS Small ribosomal subunit protein uS19 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C4L7T4 1.71e-53 164 92 0 83 3 rpsS Small ribosomal subunit protein uS19 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B7VLF3 4.36e-53 163 91 0 83 3 rpsS Small ribosomal subunit protein uS19 Vibrio atlanticus (strain LGP32)
Q7VQE4 5.24e-53 163 78 0 92 3 rpsS Small ribosomal subunit protein uS19 Blochmanniella floridana
A4VHN4 1.56e-52 162 83 0 91 3 rpsS Small ribosomal subunit protein uS19 Stutzerimonas stutzeri (strain A1501)
B1JDW0 1.82e-52 161 84 0 91 3 rpsS Small ribosomal subunit protein uS19 Pseudomonas putida (strain W619)
Q88QN1 1.82e-52 161 84 0 91 3 rpsS Small ribosomal subunit protein uS19 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK71 1.82e-52 161 84 0 91 3 rpsS Small ribosomal subunit protein uS19 Pseudomonas putida (strain GB-1)
A5VXQ1 1.82e-52 161 84 0 91 3 rpsS Small ribosomal subunit protein uS19 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IFW2 1.82e-52 161 84 0 91 3 rpsS Small ribosomal subunit protein uS19 Pseudomonas entomophila (strain L48)
B8D845 2.5e-52 161 79 0 92 3 rpsS Small ribosomal subunit protein uS19 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57587 2.5e-52 161 79 0 92 3 rpsS Small ribosomal subunit protein uS19 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9U3 2.5e-52 161 79 0 92 3 rpsS Small ribosomal subunit protein uS19 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
C1DKL7 2.76e-52 161 82 0 91 3 rpsS Small ribosomal subunit protein uS19 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B3PK41 3.36e-52 160 79 0 92 3 rpsS Small ribosomal subunit protein uS19 Cellvibrio japonicus (strain Ueda107)
Q9HWD9 5.89e-52 160 82 0 91 1 rpsS Small ribosomal subunit protein uS19 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T76 5.89e-52 160 82 0 91 3 rpsS Small ribosomal subunit protein uS19 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V648 5.89e-52 160 82 0 91 3 rpsS Small ribosomal subunit protein uS19 Pseudomonas aeruginosa (strain LESB58)
A6UZJ2 5.89e-52 160 82 0 91 3 rpsS Small ribosomal subunit protein uS19 Pseudomonas aeruginosa (strain PA7)
A4XZ86 5.96e-52 160 83 0 91 3 rpsS Small ribosomal subunit protein uS19 Pseudomonas mendocina (strain ymp)
Q889W7 6.65e-52 160 82 0 91 3 rpsS Small ribosomal subunit protein uS19 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZMP8 1.1e-51 159 82 0 91 3 rpsS Small ribosomal subunit protein uS19 Pseudomonas syringae pv. syringae (strain B728a)
Q4K537 1.1e-51 159 82 0 91 3 rpsS Small ribosomal subunit protein uS19 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48D40 1.1e-51 159 82 0 91 3 rpsS Small ribosomal subunit protein uS19 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8K954 1.12e-51 159 78 0 92 3 rpsS Small ribosomal subunit protein uS19 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
C5BQ65 3.38e-51 158 81 0 91 3 rpsS Small ribosomal subunit protein uS19 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q3K5Z2 7.69e-51 157 80 0 91 3 rpsS Small ribosomal subunit protein uS19 Pseudomonas fluorescens (strain Pf0-1)
Q057A8 1.11e-50 157 75 0 91 3 rpsS Small ribosomal subunit protein uS19 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
C3K2X2 1.83e-50 156 81 0 91 3 rpsS Small ribosomal subunit protein uS19 Pseudomonas fluorescens (strain SBW25)
B2UEL5 2.38e-50 156 80 0 91 3 rpsS Small ribosomal subunit protein uS19 Ralstonia pickettii (strain 12J)
Q21M53 3.35e-50 155 79 0 91 3 rpsS Small ribosomal subunit protein uS19 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q89A72 6.81e-50 155 75 0 92 3 rpsS Small ribosomal subunit protein uS19 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B2JI62 9.6e-50 154 80 0 91 3 rpsS Small ribosomal subunit protein uS19 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q8D208 1.49e-49 154 73 0 92 3 rpsS Small ribosomal subunit protein uS19 Wigglesworthia glossinidia brevipalpis
A5WCJ4 3.32e-49 153 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Psychrobacter sp. (strain PRwf-1)
Q13TH4 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Paraburkholderia xenovorans (strain LB400)
B2T747 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A4JAP4 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2SU31 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q15 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia pseudomallei (strain K96243)
A3NEH5 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia pseudomallei (strain 668)
Q3JMR7 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia pseudomallei (strain 1710b)
A3P0A9 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia pseudomallei (strain 1106a)
Q1BRV2 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia orbicola (strain AU 1054)
B1JU26 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia orbicola (strain MC0-3)
A1V899 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia mallei (strain SAVP1)
Q62GK9 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia mallei (strain ATCC 23344)
A2S7I0 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia mallei (strain NCTC 10229)
A3MRV8 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia mallei (strain NCTC 10247)
A9ADJ7 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia multivorans (strain ATCC 17616 / 249)
Q39KG3 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BJ42 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5C4 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3M9 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia cenocepacia (strain HI2424)
B1YRD4 5.32e-49 152 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Burkholderia ambifaria (strain MC40-6)
Q3IF21 8.7e-49 152 81 0 87 3 rpsS Small ribosomal subunit protein uS19 Pseudoalteromonas translucida (strain TAC 125)
A2SLF3 9.73e-49 152 80 0 91 3 rpsS Small ribosomal subunit protein uS19 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
C4K7B4 1.24e-48 152 77 2 94 3 rpsS Small ribosomal subunit protein uS19 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A1KRH7 1.74e-48 151 75 0 92 3 rpsS Small ribosomal subunit protein uS19 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66487 1.74e-48 151 75 0 92 3 rpsS Small ribosomal subunit protein uS19 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66486 1.74e-48 151 75 0 92 3 rpsS Small ribosomal subunit protein uS19 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3W2 1.74e-48 151 75 0 92 3 rpsS Small ribosomal subunit protein uS19 Neisseria meningitidis serogroup C (strain 053442)
Q8XV16 1.94e-48 151 79 0 91 3 rpsS Small ribosomal subunit protein uS19 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B1Y8I3 2.45e-48 151 80 0 91 3 rpsS Small ribosomal subunit protein uS19 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A9BPS2 3.75e-48 150 79 0 91 3 rpsS Small ribosomal subunit protein uS19 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q46WE8 4.78e-48 150 79 0 91 3 rpsS Small ribosomal subunit protein uS19 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A1TJ11 5.62e-48 150 77 0 92 3 rpsS Small ribosomal subunit protein uS19 Paracidovorax citrulli (strain AAC00-1)
A1WHC9 5.89e-48 150 79 0 91 3 rpsS Small ribosomal subunit protein uS19 Verminephrobacter eiseniae (strain EF01-2)
Q1LI41 6.08e-48 150 79 0 91 3 rpsS Small ribosomal subunit protein uS19 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q31IX8 9.78e-48 149 74 0 90 3 rpsS Small ribosomal subunit protein uS19 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q30Z46 9.81e-48 149 75 0 92 3 rpsS Small ribosomal subunit protein uS19 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q5F5T1 1.02e-47 149 73 0 92 3 rpsS Small ribosomal subunit protein uS19 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
C6C189 1.13e-47 149 76 0 92 3 rpsS Small ribosomal subunit protein uS19 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
B3R7R9 1.18e-47 149 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q2L2E7 1.36e-47 149 75 0 91 3 rpsS Small ribosomal subunit protein uS19 Bordetella avium (strain 197N)
C1DAS1 1.39e-47 149 73 0 91 3 rpsS Small ribosomal subunit protein uS19 Laribacter hongkongensis (strain HLHK9)
A1W2R1 1.86e-47 149 76 0 92 3 rpsS Small ribosomal subunit protein uS19 Acidovorax sp. (strain JS42)
B9MB77 1.86e-47 149 76 0 92 3 rpsS Small ribosomal subunit protein uS19 Acidovorax ebreus (strain TPSY)
Q0K623 1.99e-47 149 78 0 91 3 rpsS Small ribosomal subunit protein uS19 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A9IIZ4 2.1e-47 149 74 0 91 3 rpsS Small ribosomal subunit protein uS19 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q3SLP5 2.51e-47 148 75 0 91 3 rpsS Small ribosomal subunit protein uS19 Thiobacillus denitrificans (strain ATCC 25259)
Q1QDI2 2.8e-47 148 73 0 91 3 rpsS Small ribosomal subunit protein uS19 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FUF2 2.8e-47 148 73 0 91 3 rpsS Small ribosomal subunit protein uS19 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A6T3K0 4.95e-47 147 76 0 91 3 rpsS Small ribosomal subunit protein uS19 Janthinobacterium sp. (strain Marseille)
A4G9T4 4.95e-47 147 76 0 91 3 rpsS Small ribosomal subunit protein uS19 Herminiimonas arsenicoxydans
A1KB23 5.83e-47 147 72 0 91 3 rpsS Small ribosomal subunit protein uS19 Azoarcus sp. (strain BH72)
Q1H4N3 8.38e-47 147 74 0 91 3 rpsS Small ribosomal subunit protein uS19 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q7W2F2 1.02e-46 147 72 0 91 3 rpsS Small ribosomal subunit protein uS19 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRC1 1.02e-46 147 72 0 91 3 rpsS Small ribosomal subunit protein uS19 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B8GV54 1.11e-46 147 73 0 90 3 rpsS Small ribosomal subunit protein uS19 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q0VSJ9 1.31e-46 147 74 0 91 3 rpsS Small ribosomal subunit protein uS19 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q7VTC9 1.48e-46 146 71 0 91 3 rpsS Small ribosomal subunit protein uS19 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B5YG43 1.6e-46 146 71 0 91 3 rpsS Small ribosomal subunit protein uS19 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q605B6 1.87e-46 146 73 0 90 3 rpsS Small ribosomal subunit protein uS19 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q0ABH1 2.09e-46 146 73 0 90 3 rpsS Small ribosomal subunit protein uS19 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B0V6X2 2.3e-46 146 73 0 91 3 rpsS Small ribosomal subunit protein uS19 Acinetobacter baumannii (strain AYE)
B0VQS2 2.3e-46 146 73 0 91 3 rpsS Small ribosomal subunit protein uS19 Acinetobacter baumannii (strain SDF)
B2HZL8 2.3e-46 146 73 0 91 3 rpsS Small ribosomal subunit protein uS19 Acinetobacter baumannii (strain ACICU)
B7IA35 2.3e-46 146 73 0 91 1 rpsS Small ribosomal subunit protein uS19 Acinetobacter baumannii (strain AB0057)
B7GW06 2.3e-46 146 73 0 91 3 rpsS Small ribosomal subunit protein uS19 Acinetobacter baumannii (strain AB307-0294)
Q21RW2 2.37e-46 146 72 0 92 3 rpsS Small ribosomal subunit protein uS19 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q2YAZ3 2.39e-46 146 73 0 89 3 rpsS Small ribosomal subunit protein uS19 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q6F7R6 3.2e-46 145 72 0 91 3 rpsS Small ribosomal subunit protein uS19 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
C5CP49 5e-46 145 72 0 92 3 rpsS Small ribosomal subunit protein uS19 Variovorax paradoxus (strain S110)
Q12GW7 1.22e-45 144 73 0 92 3 rpsS Small ribosomal subunit protein uS19 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1WVB8 1.54e-45 144 70 0 91 3 rpsS Small ribosomal subunit protein uS19 Halorhodospira halophila (strain DSM 244 / SL1)
Q5P328 1.85e-45 144 70 0 91 3 rpsS Small ribosomal subunit protein uS19 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
O24693 3e-45 143 76 0 89 3 rpsS Small ribosomal subunit protein uS19 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31L11 3e-45 143 76 0 89 3 rpsS Small ribosomal subunit protein uS19 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A1VIQ4 3.02e-45 143 72 0 92 3 rpsS Small ribosomal subunit protein uS19 Polaromonas naphthalenivorans (strain CJ2)
A4SUW5 4.16e-45 143 73 0 92 3 rpsS Small ribosomal subunit protein uS19 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B1XSQ5 4.39e-45 143 73 0 92 3 rpsS Small ribosomal subunit protein uS19 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q5WZK8 4.39e-45 143 71 0 92 3 rpsS Small ribosomal subunit protein uS19 Legionella pneumophila (strain Lens)
A5IHR0 4.39e-45 143 71 0 92 3 rpsS Small ribosomal subunit protein uS19 Legionella pneumophila (strain Corby)
Q5X855 4.39e-45 143 71 0 92 3 rpsS Small ribosomal subunit protein uS19 Legionella pneumophila (strain Paris)
C1CXG2 4.45e-45 143 73 0 90 3 rpsS Small ribosomal subunit protein uS19 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
B8IYH6 4.66e-45 143 72 0 90 3 rpsS Small ribosomal subunit protein uS19 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q83ES0 6.68e-45 142 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAM8 6.68e-45 142 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD27 6.68e-45 142 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Coxiella burnetii (strain Dugway 5J108-111)
B6J259 6.68e-45 142 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Coxiella burnetii (strain CbuG_Q212)
B6J5D6 6.68e-45 142 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Coxiella burnetii (strain CbuK_Q154)
B5ELY3 7.21e-45 142 71 0 91 3 rpsS Small ribosomal subunit protein uS19 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J471 7.21e-45 142 71 0 91 3 rpsS Small ribosomal subunit protein uS19 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q1IX76 1.29e-44 142 72 0 90 3 rpsS Small ribosomal subunit protein uS19 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q3J8R8 1.31e-44 142 70 0 90 3 rpsS Small ribosomal subunit protein uS19 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q9CDW6 1.87e-44 141 70 0 92 3 rpsS Small ribosomal subunit protein uS19 Lactococcus lactis subsp. lactis (strain IL1403)
Q82X84 2.12e-44 141 70 0 89 3 rpsS Small ribosomal subunit protein uS19 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B7GJ71 2.35e-44 141 70 0 92 3 rpsS Small ribosomal subunit protein uS19 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
B9E9J5 2.49e-44 141 73 0 92 3 rpsS Small ribosomal subunit protein uS19 Macrococcus caseolyticus (strain JCSC5402)
Q47J99 3.95e-44 140 70 0 91 3 rpsS Small ribosomal subunit protein uS19 Dechloromonas aromatica (strain RCB)
A5EX78 4.22e-44 140 73 1 91 3 rpsS Small ribosomal subunit protein uS19 Dichelobacter nodosus (strain VCS1703A)
A0ALW4 6.97e-44 140 70 0 92 3 rpsS Small ribosomal subunit protein uS19 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P66484 6.97e-44 140 70 0 92 1 rpsS Small ribosomal subunit protein uS19 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DB12 6.97e-44 140 70 0 92 3 rpsS Small ribosomal subunit protein uS19 Listeria monocytogenes serotype 4a (strain HCC23)
Q71WF0 6.97e-44 140 70 0 92 3 rpsS Small ribosomal subunit protein uS19 Listeria monocytogenes serotype 4b (strain F2365)
C1KZH6 6.97e-44 140 70 0 92 3 rpsS Small ribosomal subunit protein uS19 Listeria monocytogenes serotype 4b (strain CLIP80459)
P66485 6.97e-44 140 70 0 92 3 rpsS Small ribosomal subunit protein uS19 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9Z9L0 7.2e-44 140 69 0 92 3 rpsS Small ribosomal subunit protein uS19 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q02W28 7.28e-44 140 69 0 92 3 rpsS Small ribosomal subunit protein uS19 Lactococcus lactis subsp. cremoris (strain SK11)
A2RNQ1 7.28e-44 140 69 0 92 1 rpsS Small ribosomal subunit protein uS19 Lactococcus lactis subsp. cremoris (strain MG1363)
A4IJJ3 8.4e-44 139 69 0 92 3 rpsS Small ribosomal subunit protein uS19 Geobacillus thermodenitrificans (strain NG80-2)
B0RZU4 8.44e-44 140 69 0 91 3 rpsS Small ribosomal subunit protein uS19 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q83FZ0 8.66e-44 139 68 1 93 3 rpsS Small ribosomal subunit protein uS19 Tropheryma whipplei (strain Twist)
Q83I74 8.66e-44 139 68 1 93 3 rpsS Small ribosomal subunit protein uS19 Tropheryma whipplei (strain TW08/27)
Q5WLQ8 9e-44 139 71 0 91 3 rpsS Small ribosomal subunit protein uS19 Shouchella clausii (strain KSM-K16)
B0U0Y5 9.27e-44 139 79 0 83 3 rpsS Small ribosomal subunit protein uS19 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q110B1 1.06e-43 139 70 0 91 3 rpsS Small ribosomal subunit protein uS19 Trichodesmium erythraeum (strain IMS101)
A4J115 1.09e-43 139 74 1 90 3 rpsS Small ribosomal subunit protein uS19 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B1HMX6 1.44e-43 139 71 0 92 3 rpsS Small ribosomal subunit protein uS19 Lysinibacillus sphaericus (strain C3-41)
C5D3S1 1.52e-43 139 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Geobacillus sp. (strain WCH70)
Q9RXJ8 1.64e-43 139 71 0 90 3 rpsS Small ribosomal subunit protein uS19 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A9VP81 1.87e-43 139 69 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus mycoides (strain KBAB4)
Q81J38 1.89e-43 139 69 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HJ52 1.89e-43 139 69 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus cereus (strain B4264)
Q98PY5 2.07e-43 139 70 0 91 3 rpsS Small ribosomal subunit protein uS19 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q839G0 3.74e-43 138 69 0 92 1 rpsS Small ribosomal subunit protein uS19 Enterococcus faecalis (strain ATCC 700802 / V583)
A4IZT0 4.26e-43 138 78 0 83 3 rpsS Small ribosomal subunit protein uS19 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHW4 4.26e-43 138 78 0 83 3 rpsS Small ribosomal subunit protein uS19 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BNS3 4.26e-43 138 78 0 83 3 rpsS Small ribosomal subunit protein uS19 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q4I7 4.26e-43 138 78 0 83 3 rpsS Small ribosomal subunit protein uS19 Francisella tularensis subsp. novicida (strain U112)
B2SDY1 4.26e-43 138 78 0 83 3 rpsS Small ribosomal subunit protein uS19 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A5G6 4.26e-43 138 78 0 83 3 rpsS Small ribosomal subunit protein uS19 Francisella tularensis subsp. holarctica (strain LVS)
A7N9T0 4.26e-43 138 78 0 83 3 rpsS Small ribosomal subunit protein uS19 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14JB6 4.26e-43 138 78 0 83 3 rpsS Small ribosomal subunit protein uS19 Francisella tularensis subsp. tularensis (strain FSC 198)
Q8RIF9 4.32e-43 138 72 1 91 3 rpsS Small ribosomal subunit protein uS19 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B1YGV4 4.45e-43 138 70 0 92 3 rpsS Small ribosomal subunit protein uS19 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
C4KZP2 8.82e-43 137 70 0 91 3 rpsS Small ribosomal subunit protein uS19 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A9NED7 1.16e-42 137 71 1 92 3 rpsS Small ribosomal subunit protein uS19 Acholeplasma laidlawii (strain PG-8A)
A6Q1I2 1.26e-42 137 77 0 83 3 rpsS Small ribosomal subunit protein uS19 Nitratiruptor sp. (strain SB155-2)
Q5L3Z3 1.32e-42 137 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Geobacillus kaustophilus (strain HTA426)
P12731 1.68e-42 136 67 0 92 1 rpsS Small ribosomal subunit protein uS19 Geobacillus stearothermophilus
B1XJT5 2.05e-42 136 70 1 92 3 rpsS Small ribosomal subunit protein uS19 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
C4XLX7 2.23e-42 136 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
P66495 2.28e-42 136 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Staphylococcus aureus (strain MW2)
Q6G775 2.28e-42 136 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Staphylococcus aureus (strain MSSA476)
Q6GEI7 2.28e-42 136 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Staphylococcus aureus (strain MRSA252)
P66494 2.28e-42 136 68 0 92 1 rpsS Small ribosomal subunit protein uS19 Staphylococcus aureus (strain N315)
P66493 2.28e-42 136 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJ88 2.28e-42 136 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Staphylococcus aureus (strain Newman)
Q5HDW2 2.28e-42 136 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Staphylococcus aureus (strain COL)
Q2YYQ0 2.28e-42 136 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IV30 2.28e-42 136 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Staphylococcus aureus (strain JH9)
Q2FW10 2.28e-42 136 68 0 92 1 rpsS Small ribosomal subunit protein uS19 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEP3 2.28e-42 136 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Staphylococcus aureus (strain USA300)
A6U3X1 2.28e-42 136 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Staphylococcus aureus (strain JH1)
A7X5F7 2.28e-42 136 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q0AIJ1 2.73e-42 136 65 0 89 3 rpsS Small ribosomal subunit protein uS19 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q6AP67 2.82e-42 135 67 0 91 3 rpsS Small ribosomal subunit protein uS19 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B9DSV4 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q5M2B7 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXR5 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus thermophilus (strain CNRZ 1066)
C0MCB4 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus equi subsp. zooepidemicus (strain H70)
P0DE83 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VU5 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RC18 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J910 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJ58 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JP13 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JE54 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66498 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XED1 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE82 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66496 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pyogenes serotype M1
B4U504 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M7R3 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus equi subsp. equi (strain 4047)
P66500 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66499 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus agalactiae serotype III (strain NEM316)
Q3K3W5 2.97e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
P56366 2.97e-42 135 70 1 92 3 rps19 Small ribosomal subunit protein uS19c Chlorella vulgaris
A6MW05 3.14e-42 135 67 1 92 3 rps19 Small ribosomal subunit protein uS19c Rhodomonas salina
Q20F11 3.14e-42 135 72 1 92 3 rps19 Small ribosomal subunit protein uS19c Oltmannsiellopsis viridis
C1CP92 3.2e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIA1 3.2e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pneumoniae (strain P1031)
C1CC10 3.2e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pneumoniae (strain JJA)
A4VSF8 3.2e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus suis (strain 05ZYH33)
A3CK67 3.2e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus sanguinis (strain SK36)
A4VYP7 3.2e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus suis (strain 98HAH33)
P0A4B6 3.2e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS44 3.2e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pneumoniae (strain CGSP14)
P0A4B5 3.2e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKG1 3.2e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I8K2 3.2e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pneumoniae (strain Hungary19A-6)
C1CAL6 3.2e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pneumoniae (strain 70585)
B5E6F9 3.2e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pneumoniae serotype 19F (strain G54)
Q04MN2 3.2e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A8AZM1 3.2e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A9ETF4 3.21e-42 136 70 0 90 3 rpsS Small ribosomal subunit protein uS19 Sorangium cellulosum (strain So ce56)
Q04C11 3.25e-42 135 68 0 91 3 rpsS Small ribosomal subunit protein uS19 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBL4 3.25e-42 135 68 0 91 3 rpsS Small ribosomal subunit protein uS19 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
B7KHZ1 4.41e-42 135 66 1 92 3 rpsS Small ribosomal subunit protein uS19 Gloeothece citriformis (strain PCC 7424)
Q03IF5 4.46e-42 135 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q82DP1 4.8e-42 135 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q65PA3 5.68e-42 135 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q6HPQ4 6.84e-42 135 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H86 6.84e-42 135 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus cereus (strain ZK / E33L)
B9IZJ8 6.84e-42 135 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus cereus (strain Q1)
B7HQU8 6.84e-42 135 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus cereus (strain AH187)
C1ET43 6.84e-42 135 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus cereus (strain 03BB102)
Q73F92 6.84e-42 135 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JKC3 6.84e-42 135 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus cereus (strain AH820)
Q81VS6 6.84e-42 135 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus anthracis
A0R8I4 6.84e-42 135 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus thuringiensis (strain Al Hakam)
C3LJ86 6.84e-42 135 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9Q9 6.84e-42 135 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus anthracis (strain A0248)
Q4A5C5 7.55e-42 135 69 1 92 3 rpsS Small ribosomal subunit protein uS19 Mycoplasmopsis synoviae (strain 53)
Q1MPQ9 7.61e-42 135 64 0 92 3 rpsS Small ribosomal subunit protein uS19 Lawsonia intracellularis (strain PHE/MN1-00)
B7K331 7.72e-42 135 68 1 92 3 rpsS Small ribosomal subunit protein uS19 Rippkaea orientalis (strain PCC 8801 / RF-1)
P80381 8.04e-42 134 69 0 92 1 rpsS Small ribosomal subunit protein uS19 Thermus thermophilus
Q5SHP2 8.04e-42 134 69 0 92 1 rpsS Small ribosomal subunit protein uS19 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P62660 8.04e-42 134 69 0 92 1 rpsS Small ribosomal subunit protein uS19 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A4FPM1 8.13e-42 134 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q9XD32 8.77e-42 134 67 1 93 3 rpsS Small ribosomal subunit protein uS19 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q055E0 8.77e-42 134 67 1 93 3 rpsS1 Small ribosomal subunit protein uS19 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04PU2 8.77e-42 134 67 1 93 3 rpsS Small ribosomal subunit protein uS19 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
C0Q9W9 9e-42 134 70 0 90 3 rpsS Small ribosomal subunit protein uS19 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
A7GK24 9.93e-42 134 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B2GIZ7 1.03e-41 134 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
B0JHZ9 1.1e-41 134 67 1 93 3 rpsS Small ribosomal subunit protein uS19 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q9L0D6 1.17e-41 134 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B2TIH9 1.25e-41 134 69 0 92 3 rpsS Small ribosomal subunit protein uS19 Clostridium botulinum (strain Eklund 17B / Type B)
B2UYB4 1.25e-41 134 69 0 92 3 rpsS Small ribosomal subunit protein uS19 Clostridium botulinum (strain Alaska E43 / Type E3)
Q11HQ6 1.35e-41 134 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Chelativorans sp. (strain BNC1)
Q4L8B0 1.38e-41 134 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Staphylococcus haemolyticus (strain JCSC1435)
Q8CRG4 1.38e-41 134 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM03 1.38e-41 134 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A0JZ80 1.69e-41 134 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Arthrobacter sp. (strain FB24)
C1B016 2.11e-41 134 67 1 93 3 rpsS Small ribosomal subunit protein uS19 Rhodococcus opacus (strain B4)
Q0S3H2 2.11e-41 134 67 1 93 3 rpsS Small ribosomal subunit protein uS19 Rhodococcus jostii (strain RHA1)
C0ZW29 2.11e-41 134 67 1 93 3 rpsS Small ribosomal subunit protein uS19 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
C0ZII4 2.38e-41 133 66 1 93 3 rpsS Small ribosomal subunit protein uS19 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B1MGE6 2.49e-41 133 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
B5XJ40 2.58e-41 133 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptococcus pyogenes serotype M49 (strain NZ131)
C3PKQ6 2.61e-41 133 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q7NQF6 3.04e-41 133 72 0 83 3 rpsS Small ribosomal subunit protein uS19 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P15761 3.07e-41 133 69 1 92 3 rps19 Small ribosomal subunit protein uS19c Cyanophora paradoxa
A7Z0P2 3.25e-41 133 65 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P21476 3.25e-41 133 65 0 92 1 rpsS Small ribosomal subunit protein uS19 Bacillus subtilis (strain 168)
B1W403 3.46e-41 133 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B8HMQ8 3.51e-41 133 70 1 91 3 rpsS Small ribosomal subunit protein uS19 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
P73316 3.58e-41 133 68 1 92 3 rpsS Small ribosomal subunit protein uS19 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A8G758 3.58e-41 133 69 0 91 3 rpsS Small ribosomal subunit protein uS19 Prochlorococcus marinus (strain MIT 9215)
B8HD02 3.69e-41 133 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A2BTD3 3.87e-41 133 69 0 91 3 rpsS Small ribosomal subunit protein uS19 Prochlorococcus marinus (strain AS9601)
A3PF43 3.87e-41 133 69 0 91 3 rpsS Small ribosomal subunit protein uS19 Prochlorococcus marinus (strain MIT 9301)
A8F989 3.87e-41 133 65 0 92 3 rpsS Small ribosomal subunit protein uS19 Bacillus pumilus (strain SAFR-032)
P9WH45 3.94e-41 133 66 0 92 1 rpsS Small ribosomal subunit protein uS19 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WH44 3.94e-41 133 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U091 3.94e-41 133 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AL39 3.94e-41 133 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KGI6 3.94e-41 133 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A5X5 3.94e-41 133 66 0 92 1 rpsS Small ribosomal subunit protein uS19 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A1SNL4 4.26e-41 133 68 1 93 3 rpsS Small ribosomal subunit protein uS19 Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q0ANQ4 4.27e-41 133 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Maricaulis maris (strain MCS10)
B1WQR4 4.32e-41 133 68 1 92 3 rpsS Small ribosomal subunit protein uS19 Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q73SB0 4.35e-41 133 67 1 93 3 rpsS Small ribosomal subunit protein uS19 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QL14 4.35e-41 133 67 1 93 3 rpsS Small ribosomal subunit protein uS19 Mycobacterium avium (strain 104)
Q72NG5 4.4e-41 133 66 1 93 3 rpsS Small ribosomal subunit protein uS19 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B0C1D7 4.42e-41 133 70 1 91 3 rpsS Small ribosomal subunit protein uS19 Acaryochloris marina (strain MBIC 11017)
B2A4E3 4.44e-41 133 72 0 83 3 rpsS Small ribosomal subunit protein uS19 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B9DM27 4.46e-41 133 65 0 92 3 rpsS Small ribosomal subunit protein uS19 Staphylococcus carnosus (strain TM300)
A0PM67 4.6e-41 133 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Mycobacterium ulcerans (strain Agy99)
B2HSN5 4.6e-41 133 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Mycobacterium marinum (strain ATCC BAA-535 / M)
A0LIJ4 4.83e-41 133 66 0 86 3 rpsS Small ribosomal subunit protein uS19 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q318I8 4.87e-41 132 69 0 91 3 rpsS Small ribosomal subunit protein uS19 Prochlorococcus marinus (strain MIT 9312)
A5IYY2 5.04e-41 132 71 1 92 3 rpsS Small ribosomal subunit protein uS19 Mycoplasmopsis agalactiae (strain NCTC 10123 / CIP 59.7 / PG2)
C4ZBS3 5.3e-41 132 71 0 88 3 rpsS Small ribosomal subunit protein uS19 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
A0LRM4 5.66e-41 132 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
A8LC52 5.98e-41 132 65 0 92 3 rpsS Small ribosomal subunit protein uS19 Parafrankia sp. (strain EAN1pec)
B8DNA0 5.98e-41 132 72 0 83 3 rpsS Small ribosomal subunit protein uS19 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
O32985 6.05e-41 132 67 1 93 3 rpsS Small ribosomal subunit protein uS19 Mycobacterium leprae (strain TN)
B8ZSB5 6.05e-41 132 67 1 93 3 rpsS Small ribosomal subunit protein uS19 Mycobacterium leprae (strain Br4923)
A4TEC0 6.05e-41 132 67 1 93 3 rpsS Small ribosomal subunit protein uS19 Mycolicibacterium gilvum (strain PYR-GCK)
A1T4P3 6.25e-41 132 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A0QSD5 6.25e-41 132 66 0 92 1 rpsS Small ribosomal subunit protein uS19 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q4JT51 6.55e-41 132 68 0 88 3 rpsS Small ribosomal subunit protein uS19 Corynebacterium jeikeium (strain K411)
Q2JIM3 6.9e-41 132 68 1 93 3 rpsS Small ribosomal subunit protein uS19 Synechococcus sp. (strain JA-2-3B'a(2-13))
P66482 7.23e-41 132 69 0 88 3 rpsS Small ribosomal subunit protein uS19 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QBI5 7.23e-41 132 69 0 88 3 rpsS Small ribosomal subunit protein uS19 Corynebacterium glutamicum (strain R)
P66483 7.23e-41 132 69 0 88 3 rpsS Small ribosomal subunit protein uS19 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
C5CC58 7.62e-41 132 68 0 92 3 rpsS Small ribosomal subunit protein uS19 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
Q6NJD1 7.98e-41 132 65 0 92 3 rpsS Small ribosomal subunit protein uS19 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q2JV85 8.98e-41 132 67 1 93 3 rpsS Small ribosomal subunit protein uS19 Synechococcus sp. (strain JA-3-3Ab)
Q6ACZ9 9.38e-41 132 66 0 92 3 rpsS Small ribosomal subunit protein uS19 Leifsonia xyli subsp. xyli (strain CTCB07)
B2FQ49 9.82e-41 132 68 1 91 3 rpsS Small ribosomal subunit protein uS19 Stenotrophomonas maltophilia (strain K279a)
A5CXK8 1e-40 132 67 0 89 3 rpsS Small ribosomal subunit protein uS19 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q46IR3 1.09e-40 132 67 0 91 3 rpsS Small ribosomal subunit protein uS19 Prochlorococcus marinus (strain NATL2A)
A2C4Z5 1.09e-40 132 67 0 91 3 rpsS Small ribosomal subunit protein uS19 Prochlorococcus marinus (strain NATL1A)
A1AVK4 1.13e-40 132 67 0 89 3 rpsS Small ribosomal subunit protein uS19 Ruthia magnifica subsp. Calyptogena magnifica
A7HWR5 1.18e-40 132 67 0 91 3 rpsS Small ribosomal subunit protein uS19 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A6QCQ2 1.25e-40 132 72 0 83 3 rpsS Small ribosomal subunit protein uS19 Sulfurovum sp. (strain NBC37-1)
Q0SQE8 1.3e-40 132 64 0 92 3 rpsS Small ribosomal subunit protein uS19 Clostridium perfringens (strain SM101 / Type A)
Q8XHS7 1.3e-40 132 64 0 92 3 rpsS Small ribosomal subunit protein uS19 Clostridium perfringens (strain 13 / Type A)
Q0TMQ0 1.3e-40 132 64 0 92 3 rpsS Small ribosomal subunit protein uS19 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A1R8U1 1.33e-40 131 65 0 92 3 rpsS Small ribosomal subunit protein uS19 Paenarthrobacter aurescens (strain TC1)
A2BYT2 1.46e-40 131 68 0 91 3 rpsS Small ribosomal subunit protein uS19 Prochlorococcus marinus (strain MIT 9515)
Q0RRR7 1.55e-40 131 65 0 92 3 rpsS Small ribosomal subunit protein uS19 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q2JFH2 1.64e-40 131 65 0 92 3 rpsS Small ribosomal subunit protein uS19 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q7TU27 1.69e-40 131 68 0 91 3 rpsS Small ribosomal subunit protein uS19 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
A1VEB2 1.87e-40 131 69 0 83 3 rpsS Small ribosomal subunit protein uS19 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CH6 1.87e-40 131 69 0 83 3 rpsS Small ribosomal subunit protein uS19 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q1BDA3 1.87e-40 131 65 0 92 3 rpsS Small ribosomal subunit protein uS19 Mycobacterium sp. (strain MCS)
A1UBP0 1.87e-40 131 65 0 92 3 rpsS Small ribosomal subunit protein uS19 Mycobacterium sp. (strain KMS)
A3PVC5 1.87e-40 131 65 0 92 3 rpsS Small ribosomal subunit protein uS19 Mycobacterium sp. (strain JLS)
A9KJJ0 1.88e-40 131 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A4XBP2 1.93e-40 131 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A8M525 1.93e-40 131 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Salinispora arenicola (strain CNS-205)
A5D5J4 2.02e-40 131 69 0 85 3 rpsS Small ribosomal subunit protein uS19 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q0ID09 2.15e-40 131 70 0 89 3 rpsS Small ribosomal subunit protein uS19 Synechococcus sp. (strain CC9311)
Q03ZP1 2.17e-40 131 69 0 88 3 rpsS Small ribosomal subunit protein uS19 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q3AMN4 2.27e-40 131 68 0 91 3 rpsS Small ribosomal subunit protein uS19 Synechococcus sp. (strain CC9605)
B0RB43 2.28e-40 131 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Clavibacter sepedonicus
A5CUA9 2.28e-40 131 67 0 92 3 rpsS Small ribosomal subunit protein uS19 Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
B2GDW5 2.31e-40 131 69 0 88 3 rpsS Small ribosomal subunit protein uS19 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q7V9W6 2.35e-40 131 70 0 89 3 rpsS Small ribosomal subunit protein uS19 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q5GWT8 2.39e-40 130 67 1 91 3 rpsS Small ribosomal subunit protein uS19 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQR4 2.39e-40 130 67 1 91 3 rpsS Small ribosomal subunit protein uS19 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZY9 2.39e-40 130 67 1 91 3 rpsS Small ribosomal subunit protein uS19 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PC45 2.39e-40 130 67 1 91 3 rpsS Small ribosomal subunit protein uS19 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU78 2.39e-40 130 67 1 91 3 rpsS Small ribosomal subunit protein uS19 Xanthomonas campestris pv. campestris (strain B100)
Q4URE3 2.39e-40 130 67 1 91 3 rpsS Small ribosomal subunit protein uS19 Xanthomonas campestris pv. campestris (strain 8004)
A6YGC5 2.51e-40 131 67 1 94 3 rps19 Small ribosomal subunit protein uS19c Pleurastrum terricola
B0SSH3 2.55e-40 131 65 0 92 3 rpsS Small ribosomal subunit protein uS19 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SA43 2.55e-40 131 65 0 92 3 rpsS Small ribosomal subunit protein uS19 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
B1VEU0 2.55e-40 131 68 0 86 3 rpsS Small ribosomal subunit protein uS19 Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
C4LL48 2.67e-40 130 64 0 92 3 rpsS Small ribosomal subunit protein uS19 Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
B1MW10 2.87e-40 130 68 0 88 3 rpsS Small ribosomal subunit protein uS19 Leuconostoc citreum (strain KM20)
A9BCP3 3.05e-40 130 67 0 91 3 rpsS Small ribosomal subunit protein uS19 Prochlorococcus marinus (strain MIT 9211)
Q3MFB7 3.47e-40 130 70 1 90 3 rpsS Small ribosomal subunit protein uS19 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q7U4J6 3.68e-40 130 68 0 89 3 rpsS Small ribosomal subunit protein uS19 Parasynechococcus marenigrum (strain WH8102)
Q8YPI3 3.75e-40 130 70 1 90 3 rpsS Small ribosomal subunit protein uS19 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3BWX9 3.91e-40 130 68 1 89 3 rpsS Small ribosomal subunit protein uS19 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PNS0 3.91e-40 130 68 1 89 3 rpsS Small ribosomal subunit protein uS19 Xanthomonas axonopodis pv. citri (strain 306)
B2ITQ1 4.18e-40 130 71 1 90 3 rpsS Small ribosomal subunit protein uS19 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q03EC0 4.5e-40 130 73 2 89 3 rpsS Small ribosomal subunit protein uS19 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q8ETX8 4.93e-40 130 65 0 92 3 rpsS Small ribosomal subunit protein uS19 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q6A6N0 5.92e-40 130 66 1 93 1 rpsS Small ribosomal subunit protein uS19 Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q4AAE4 6.6e-40 130 67 0 90 3 rpsS Small ribosomal subunit protein uS19 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q4A8H5 6.6e-40 130 67 0 90 3 rpsS Small ribosomal subunit protein uS19 Mesomycoplasma hyopneumoniae (strain 7448)
Q601L1 6.6e-40 130 67 0 90 3 rpsS Small ribosomal subunit protein uS19 Mesomycoplasma hyopneumoniae (strain 232)
Q32RV6 7.01e-40 130 67 1 92 3 rps19 Small ribosomal subunit protein uS19c Staurastrum punctulatum

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18940
Feature type CDS
Gene rpsS
Product 30S ribosomal protein S19
Location 9658 - 9936 (strand: 1)
Length 279 (nucleotides) / 92 (amino acids)

Contig

Accession term accessions NZ_VXKB01000011 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 30728 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2395
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00203 Ribosomal protein S19

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0185 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S19

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02965 small subunit ribosomal protein S19 Ribosome -

Protein Sequence

MPRSLKKGPFIDLHLLKKVEKAVESGDKKPVKTWSRRSTIFPNMIGLTIAVHNGRQHVPVYVTDEMVGHKLGEFAPTRTYRGHVADKKAKKK

Flanking regions ( +/- flanking 50bp)

GAACACTTCATCGTTCATCGTCGTACTAAGAAATAATTAGAGGATAAGCCATGCCACGTTCTCTCAAGAAAGGTCCTTTTATTGACCTGCACTTGCTGAAGAAGGTAGAGAAAGCGGTGGAAAGCGGTGACAAAAAGCCTGTTAAGACTTGGTCCCGTCGTTCAACGATCTTTCCTAACATGATCGGTTTGACCATCGCTGTCCATAATGGTCGTCAGCATGTTCCTGTTTATGTCACCGATGAAATGGTCGGTCATAAATTGGGCGAATTCGCGCCGACTCGTACTTATCGCGGCCATGTGGCTGATAAAAAAGCCAAAAAGAAATAAGGTAGGAGGAAGAGATGGAAACTATTGCTATGCATCGCCACGCTCGTTCT