Homologs in group_3875

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS18665 PMI_RS18665 34.0 Proteus mirabilis HI4320 - ArsA-related P-loop ATPase

Distribution of the homologs in the orthogroup group_3875

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3875

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
D0KZ82 2.58e-14 72 28 7 221 1 mcdA Maintenance of carboxysome distribution protein A Halothiobacillus neapolitanus (strain ATCC 23641 / c2)
U5QDF4 7.77e-05 45 25 7 216 3 mcdA Maintenance of carboxysome distribution protein A Gloeobacter kilaueensis (strain ATCC BAA-2537 / CCAP 1431/1 / ULC 316 / JS1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18110
Feature type CDS
Gene -
Product division plane positioning ATPase MipZ
Location 64496 - 65179 (strand: -1)
Length 684 (nucleotides) / 227 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000008
Length 103951 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3875
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF09140 ATPase MipZ

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1192 Cell cycle control, cell division, chromosome partitioning (D)
Cell motility (N)
DN ParA-like ATPase involved in chromosome/plasmid partitioning or cellulose biosynthesis protein BcsQ

Protein Sequence

MSAKIILVGGSKGGPGKSTIAQQIAGHLLIKEKKNVHLLDIDVQRTTYQWCQDREAMASGENLAKLSYHYRADGVLDYLRGIQDQHDYIVVDAGGFDSESQREAMLVATHLLLPIRPKRRDLRSLVALDQVVEKAQILNGALKVRVVMNQCPSLPNQFSRIQGAKDVCETFGMTALDTNIYARNVYDDAEEAGRTIFELPKGERDKKAEAEIKLLVKEFVFGEKVDG

Flanking regions ( +/- flanking 50bp)

ATAAAATAATAAGGCGGTGTACAAAATAACTATACAAATAAGGCAAATCCATGAGTGCAAAAATCATACTGGTTGGTGGCAGTAAAGGTGGCCCGGGTAAAAGCACAATCGCACAGCAGATAGCCGGGCATCTGTTGATCAAAGAAAAGAAAAACGTCCACCTGCTCGATATCGACGTTCAGAGAACAACCTATCAGTGGTGTCAGGATCGGGAAGCAATGGCTTCCGGTGAAAATCTGGCAAAACTATCATATCACTACCGCGCCGACGGTGTTCTCGATTACCTGCGCGGCATTCAGGATCAGCATGACTATATCGTCGTTGATGCCGGAGGCTTTGACTCCGAGTCTCAGCGTGAGGCGATGCTGGTTGCCACACACCTGTTACTGCCTATCCGTCCTAAACGCCGCGATTTACGTTCGCTGGTGGCTCTGGATCAGGTTGTGGAAAAAGCACAAATTCTGAATGGAGCACTGAAAGTCAGAGTCGTTATGAATCAGTGCCCGTCACTGCCTAACCAGTTCTCGCGTATTCAGGGCGCAAAAGACGTATGCGAGACATTCGGCATGACTGCCTTAGATACCAATATTTATGCCCGTAACGTTTATGACGATGCGGAAGAAGCCGGCCGCACTATTTTTGAATTGCCAAAAGGCGAGCGTGACAAAAAGGCTGAGGCTGAAATTAAATTATTAGTGAAAGAATTTGTATTCGGGGAGAAAGTAGATGGCTAAGAATCCTATGGGCGGGCTGGGAAAACAGGCGCGTGAAGAAGCCGTTCAGG