Homologs in group_4228

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4228

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4228

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18045
Feature type CDS
Gene -
Product AbrB/MazE/SpoVT family DNA-binding domain-containing protein
Location 53865 - 54137 (strand: -1)
Length 273 (nucleotides) / 90 (amino acids)

Contig

Accession term accessions NZ_VXKB01000008 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 103951 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_4228
Orthogroup size 1
N. genomes 1

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2336 Defense mechanisms (V) V Antitoxin component MazE of the MazEF toxin-antitoxin module

Protein Sequence

MTTTRLRQQGGAVVLTIPSDIAARLGWVVGKTLDIREAGDSINISPSKRAARGRKSVSWILDGIDENEIQSFNEGMADEMASQPVGNEVI

Flanking regions ( +/- flanking 50bp)

GTATGAATGTGCTACTATATAAGTGAGACAAAGTTACACATGGGGGATTTATGACTACTACACGTTTGCGTCAACAAGGCGGCGCGGTCGTTCTGACAATACCAAGCGATATAGCTGCACGGTTAGGCTGGGTTGTCGGGAAAACACTGGATATCAGAGAAGCCGGCGATTCGATCAACATCAGCCCAAGCAAAAGAGCGGCAAGAGGCAGAAAATCCGTTTCATGGATTTTAGATGGCATAGATGAAAATGAGATTCAATCTTTTAACGAGGGGATGGCTGATGAAATGGCCTCTCAACCTGTTGGTAATGAGGTTATTTGATGGTACGCAGGAAAAGCACACCGGCAAAAGGTGATATTTGGCATGTTAAT