Homologs in group_3814

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS02160 F4V73_RS02160 28.2 Morganella psychrotolerans - type II toxin-antitoxin system PemK/MazF family toxin

Distribution of the homologs in the orthogroup group_3814

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3814

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P13976 1.71e-21 85 38 1 119 1 pemK Endoribonuclease PemK Escherichia coli
P33647 2.65e-15 69 42 3 110 1 chpB Endoribonuclease toxin ChpB Escherichia coli (strain K12)
P0AE70 2.31e-05 43 31 3 106 1 mazF Endoribonuclease toxin MazF Escherichia coli (strain K12)
P0AE71 2.31e-05 43 31 3 106 3 mazF Endoribonuclease MazF Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18040
Feature type CDS
Gene -
Product type II toxin-antitoxin system PemK/MazF family toxin
Location 53494 - 53865 (strand: -1)
Length 372 (nucleotides) / 123 (amino acids)

Contig

Accession term accessions NZ_VXKB01000008 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 103951 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3814
Orthogroup size 2
N. genomes 1

Actions

Genomic region

Domains

PF02452 PemK-like, MazF-like toxin of type II toxin-antitoxin system

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2337 Defense mechanisms (V) V mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K18841 mRNA interferase ChpB [EC:3.1.-.-] - -

Protein Sequence

MVRRKSTPAKGDIWHVNGDPASGKEFKGPHYYLVISDQGINQALGVAICLPITSGGGLARSQSVTVSIDGSSTDKGLVTGVVLCYQIRTMDLAARKASYHSKVAPEIMDEVLGIVVDIIDPQP

Flanking regions ( +/- flanking 50bp)

GGGATGGCTGATGAAATGGCCTCTCAACCTGTTGGTAATGAGGTTATTTGATGGTACGCAGGAAAAGCACACCGGCAAAAGGTGATATTTGGCATGTTAATGGTGATCCGGCCAGTGGCAAAGAGTTTAAAGGCCCTCATTACTATTTGGTCATTTCCGATCAGGGAATTAATCAGGCATTAGGGGTCGCCATTTGTCTTCCGATCACAAGCGGTGGCGGACTTGCCCGTTCTCAGTCCGTCACCGTCAGCATTGATGGCAGCAGTACCGATAAGGGGTTAGTGACCGGTGTCGTATTGTGCTATCAGATCCGGACAATGGATTTAGCTGCACGCAAAGCCAGTTATCATTCAAAAGTCGCACCGGAAATAATGGATGAAGTGCTGGGAATCGTAGTTGATATCATCGATCCACAACCATAGTCATAACCGCATTACTTTCCTTTAAAACACGCCCTTATGACTCCAGACTT