Homologs in group_4931

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4931

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4931

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18030
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 51874 - 52257 (strand: 1)
Length 384 (nucleotides) / 127 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000008
Length 103951 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_4931
Orthogroup size 1
N. genomes 1

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MKDNRIGDFLTAAILASGKPQSQIAEECGYSAHNNISMLKSGKMLFPVAKIPDFAKALNVDEGALFRIVMQVRYPEIFAMYTRNAEPITEDEKMVLEAYRKQKGDDDYDKNLAAIRADEFIKKATQD

Flanking regions ( +/- flanking 50bp)

AAAAATAGTGATGCTTGACACTACTCTCAATAACAGATAAGGCTAATTGAATGAAAGACAACAGAATAGGTGATTTTCTGACCGCTGCTATTCTTGCCAGCGGTAAGCCGCAAAGTCAAATTGCGGAAGAATGCGGGTATTCGGCGCATAATAATATTTCAATGTTAAAATCCGGAAAAATGCTTTTTCCAGTCGCTAAAATACCTGATTTTGCTAAAGCGTTGAATGTTGATGAAGGGGCCTTATTCCGTATTGTTATGCAGGTTCGGTATCCTGAAATTTTCGCCATGTATACCCGGAACGCAGAGCCAATTACAGAAGATGAAAAAATGGTTCTGGAGGCTTACCGGAAGCAAAAAGGCGACGATGATTATGACAAAAACCTCGCCGCGATCAGAGCCGATGAATTTATAAAAAAGGCGACACAAGACTAACCAGTGCAATATACTTTTGAGGTCGGTGGTAGTCTCAATCCACCGACCTC