Homologs in group_2123

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15590 FBDBKF_15590 95.7 Morganella morganii S1 rpmH 50S ribosomal protein L34
EHELCC_15950 EHELCC_15950 95.7 Morganella morganii S2 rpmH 50S ribosomal protein L34
NLDBIP_16420 NLDBIP_16420 95.7 Morganella morganii S4 rpmH 50S ribosomal protein L34
LHKJJB_16385 LHKJJB_16385 95.7 Morganella morganii S3 rpmH 50S ribosomal protein L34
HKOGLL_16155 HKOGLL_16155 95.7 Morganella morganii S5 rpmH 50S ribosomal protein L34
PMI_RS15495 PMI_RS15495 91.3 Proteus mirabilis HI4320 rpmH 50S ribosomal protein L34

Distribution of the homologs in the orthogroup group_2123

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2123

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1JRQ5 9.17e-25 88 97 0 46 3 rpmH Large ribosomal subunit protein bL34 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q663T0 9.17e-25 88 97 0 46 3 rpmH Large ribosomal subunit protein bL34 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TSL4 9.17e-25 88 97 0 46 3 rpmH Large ribosomal subunit protein bL34 Yersinia pestis (strain Pestoides F)
Q1CCJ7 9.17e-25 88 97 0 46 3 rpmH Large ribosomal subunit protein bL34 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R5R6 9.17e-25 88 97 0 46 3 rpmH Large ribosomal subunit protein bL34 Yersinia pestis bv. Antiqua (strain Angola)
Q8Z9U5 9.17e-25 88 97 0 46 3 rpmH Large ribosomal subunit protein bL34 Yersinia pestis
B2K872 9.17e-25 88 97 0 46 3 rpmH Large ribosomal subunit protein bL34 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0B7 9.17e-25 88 97 0 46 3 rpmH Large ribosomal subunit protein bL34 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FPB8 9.17e-25 88 97 0 46 3 rpmH Large ribosomal subunit protein bL34 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JT83 9.17e-25 88 97 0 46 3 rpmH Large ribosomal subunit protein bL34 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4WGH5 9.17e-25 88 97 0 46 3 rpmH Large ribosomal subunit protein bL34 Enterobacter sp. (strain 638)
Q7MXZ2 1.57e-24 87 97 0 46 3 rpmH Large ribosomal subunit protein bL34 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8G7Q1 4.61e-24 86 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Serratia proteamaculans (strain 568)
Q6CYR2 4.61e-24 86 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NQ68 1.71e-23 85 95 0 45 3 rpmH Large ribosomal subunit protein bL34 Sodalis glossinidius (strain morsitans)
B2VCE4 2.24e-23 85 93 0 46 3 rpmH Large ribosomal subunit protein bL34 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C4K7P8 3.6e-23 84 95 0 45 3 rpmH Large ribosomal subunit protein bL34 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
P29437 2.7e-21 79 86 0 45 3 rpmH Large ribosomal subunit protein bL34 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B8D6T2 2.98e-21 79 86 0 45 3 rpmH Large ribosomal subunit protein bL34 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57129 2.98e-21 79 86 0 45 3 rpmH Large ribosomal subunit protein bL34 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8H8 2.98e-21 79 86 0 45 3 rpmH Large ribosomal subunit protein bL34 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q89B35 1.45e-20 77 84 0 45 3 rpmH Large ribosomal subunit protein bL34 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B0URU6 6.07e-20 76 86 0 44 3 rpmH Large ribosomal subunit protein bL34 Histophilus somni (strain 2336)
Q0I0Y8 6.07e-20 76 86 0 44 3 rpmH Large ribosomal subunit protein bL34 Histophilus somni (strain 129Pt)
A9KBT4 1.24e-19 75 86 0 44 3 rpmH Large ribosomal subunit protein bL34 Coxiella burnetii (strain Dugway 5J108-111)
B6J8U4 1.24e-19 75 86 0 44 3 rpmH Large ribosomal subunit protein bL34 Coxiella burnetii (strain CbuK_Q154)
A5WBC0 1.32e-19 75 86 0 44 3 rpmH Large ribosomal subunit protein bL34 Psychrobacter sp. (strain PRwf-1)
Q1QEW7 1.32e-19 75 86 0 44 3 rpmH Large ribosomal subunit protein bL34 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FPR4 1.32e-19 75 86 0 44 3 rpmH Large ribosomal subunit protein bL34 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
C1DNG0 1.56e-19 75 86 0 44 3 rpmH Large ribosomal subunit protein bL34 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q7VQV0 2.34e-19 74 77 0 45 3 rpmH Large ribosomal subunit protein bL34 Blochmanniella floridana
A4VS85 3.45e-19 74 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Stutzerimonas stutzeri (strain A1501)
P66245 4.25e-19 73 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Pasteurella multocida (strain Pm70)
Q65VB9 4.25e-19 73 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P66244 4.25e-19 73 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UID2 4.25e-19 73 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Haemophilus influenzae (strain PittGG)
A5UD74 4.25e-19 73 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Haemophilus influenzae (strain PittEE)
Q4QLR3 4.25e-19 73 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Haemophilus influenzae (strain 86-028NP)
A6VR64 4.25e-19 73 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P29436 4.39e-19 73 86 0 44 1 rpmH Large ribosomal subunit protein bL34 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6VF47 4.39e-19 73 86 0 44 3 rpmH Large ribosomal subunit protein bL34 Pseudomonas aeruginosa (strain PA7)
Q7VN33 9.06e-19 73 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B8F7T1 9.06e-19 73 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Glaesserella parasuis serovar 5 (strain SH0165)
B0BTL8 9.06e-19 73 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H308 9.06e-19 73 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N3N0 9.06e-19 73 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
P45647 1.22e-18 72 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBA2 1.22e-18 72 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J2B1 1.22e-18 72 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Coxiella burnetii (strain CbuG_Q212)
A4Y1A3 3.04e-18 72 81 0 44 3 rpmH Large ribosomal subunit protein bL34 Pseudomonas mendocina (strain ymp)
Q31DI6 3.66e-18 71 81 0 44 3 rpmH Large ribosomal subunit protein bL34 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q0VKU5 6.06e-18 71 79 0 44 3 rpmH Large ribosomal subunit protein bL34 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q15MS4 6.34e-18 71 81 0 44 3 rpmH Large ribosomal subunit protein bL34 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q21DF7 6.41e-18 71 79 0 44 3 rpmH Large ribosomal subunit protein bL34 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q3YWB1 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Shigella sonnei (strain Ss046)
P0A7Q0 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Shigella flexneri
Q0SYP3 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Shigella flexneri serotype 5b (strain 8401)
Q329B5 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Shigella dysenteriae serotype 1 (strain Sd197)
Q31UV6 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Shigella boydii serotype 4 (strain Sb227)
B2TUS5 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P0A7P8 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A7P9 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Salmonella typhi
B4TN08 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Salmonella schwarzengrund (strain CVM19633)
B5BIL5 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Salmonella paratyphi A (strain AKU_12601)
C0Q2L0 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Salmonella paratyphi C (strain RKS4594)
A9MX79 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKU5 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SYA9 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Salmonella newport (strain SL254)
B4TAV0 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Salmonella heidelberg (strain SL476)
B5RFY6 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QUQ1 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Salmonella enteritidis PT4 (strain P125109)
B5FN11 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Salmonella dublin (strain CT_02021853)
Q57HZ9 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Salmonella choleraesuis (strain SC-B67)
A9MJT9 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5EYX3 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Salmonella agona (strain SL483)
A6TG05 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XZP7 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Klebsiella pneumoniae (strain 342)
B7LK45 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R4N3 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli (strain UTI89 / UPEC)
B1LL30 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli (strain SMS-3-5 / SECEC)
B6I3T6 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli (strain SE11)
B7NF20 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7P5 6.61e-18 71 95 0 46 1 rpmH Large ribosomal subunit protein bL34 Escherichia coli (strain K12)
B1IX36 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7P6 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A6G4 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli O9:H4 (strain HS)
B1X9T1 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli (strain K12 / DH10B)
C4ZYY0 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M555 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli O8 (strain IAI1)
B7N2E8 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli O81 (strain ED1a)
B7NR05 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YXA7 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7P7 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli O157:H7
B7L847 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli (strain 55989 / EAEC)
B7MGC4 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UMH0 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTQ9 6.61e-18 71 95 0 46 3 rpmH Large ribosomal subunit protein bL34 Escherichia coli O139:H28 (strain E24377A / ETEC)
Q5QZK0 7.39e-18 70 81 0 44 3 rpmH Large ribosomal subunit protein bL34 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
C3K1G4 8.91e-18 70 79 0 44 3 rpmH Large ribosomal subunit protein bL34 Pseudomonas fluorescens (strain SBW25)
Q4K394 8.91e-18 70 79 0 44 3 rpmH Large ribosomal subunit protein bL34 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A5EY32 1.1e-17 70 83 0 43 3 rpmH Large ribosomal subunit protein bL34 Dichelobacter nodosus (strain VCS1703A)
B0V5R3 1.56e-17 70 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Acinetobacter baumannii (strain AYE)
A3M8Z3 1.56e-17 70 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B7IBH8 1.56e-17 70 84 0 44 1 rpmH Large ribosomal subunit protein bL34 Acinetobacter baumannii (strain AB0057)
B7H343 1.56e-17 70 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Acinetobacter baumannii (strain AB307-0294)
Q6F6K7 1.56e-17 70 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q4ZL08 1.6e-17 70 79 0 44 3 rpmH Large ribosomal subunit protein bL34 Pseudomonas syringae pv. syringae (strain B728a)
Q87TR8 1.6e-17 70 79 0 44 3 rpmH Large ribosomal subunit protein bL34 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48BE9 1.6e-17 70 79 0 44 3 rpmH Large ribosomal subunit protein bL34 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A1U7J7 1.67e-17 70 79 0 44 3 rpmH Large ribosomal subunit protein bL34 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B0VQP8 1.9e-17 70 84 0 44 3 rpmH Large ribosomal subunit protein bL34 Acinetobacter baumannii (strain SDF)
C6DKA0 2.19e-17 69 93 0 46 3 rpmH Large ribosomal subunit protein bL34 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
P0A162 2.24e-17 69 77 0 44 3 rpmH Large ribosomal subunit protein bL34 Pseudomonas putida
P0A161 2.24e-17 69 77 0 44 3 rpmH Large ribosomal subunit protein bL34 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KEU8 2.24e-17 69 77 0 44 3 rpmH Large ribosomal subunit protein bL34 Pseudomonas putida (strain GB-1)
Q1I2H1 2.24e-17 69 77 0 44 3 rpmH Large ribosomal subunit protein bL34 Pseudomonas entomophila (strain L48)
Q0A4L3 3.76e-17 69 81 0 43 3 rpmH Large ribosomal subunit protein bL34 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B5FEU9 4.15e-17 68 81 0 43 3 rpmH Large ribosomal subunit protein bL34 Aliivibrio fischeri (strain MJ11)
Q5E8Z6 4.15e-17 68 81 0 43 3 rpmH Large ribosomal subunit protein bL34 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q3IK51 5.06e-17 68 81 0 43 3 rpmH Large ribosomal subunit protein bL34 Pseudoalteromonas translucida (strain TAC 125)
P22836 9.03e-17 68 93 0 45 3 rpmH Large ribosomal subunit protein bL34 Proteus mirabilis
B4F0U4 9.03e-17 68 93 0 45 3 rpmH Large ribosomal subunit protein bL34 Proteus mirabilis (strain HI4320)
A6W3V3 9.05e-17 68 79 0 43 3 rpmH Large ribosomal subunit protein bL34 Marinomonas sp. (strain MWYL1)
A1T0M6 9.99e-17 68 77 0 44 3 rpmH Large ribosomal subunit protein bL34 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q494B7 1.51e-16 67 68 0 45 3 rpmH Large ribosomal subunit protein bL34 Blochmanniella pennsylvanica (strain BPEN)
Q87TR3 1.77e-16 67 76 0 43 3 rpmH Large ribosomal subunit protein bL34 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7N1E5 1.77e-16 67 76 0 43 3 rpmH Large ribosomal subunit protein bL34 Vibrio campbellii (strain ATCC BAA-1116)
B3PIU4 1.93e-16 67 81 0 43 3 rpmH Large ribosomal subunit protein bL34 Cellvibrio japonicus (strain Ueda107)
B6EP42 2.23e-16 67 79 0 43 3 rpmH Large ribosomal subunit protein bL34 Aliivibrio salmonicida (strain LFI1238)
Q7MQK3 4.07e-16 66 78 0 42 3 rpmH Large ribosomal subunit protein bL34 Vibrio vulnificus (strain YJ016)
Q8DDI4 4.07e-16 66 78 0 42 3 rpmH Large ribosomal subunit protein bL34 Vibrio vulnificus (strain CMCP6)
B8GRD4 5.93e-16 66 76 0 43 3 rpmH Large ribosomal subunit protein bL34 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q1IY21 6.25e-16 66 75 0 45 3 rpmH Large ribosomal subunit protein bL34 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
B5RRP3 6.25e-16 66 73 0 45 3 rpmH Large ribosomal subunit protein bL34 Borrelia recurrentis (strain A1)
B5RLZ7 6.25e-16 66 73 0 45 3 rpmH Large ribosomal subunit protein bL34 Borrelia duttonii (strain Ly)
A1QZM6 7.13e-16 66 73 0 45 3 rpmH Large ribosomal subunit protein bL34 Borrelia turicatae (strain 91E135)
Q8D3I7 8.22e-16 65 68 0 45 3 rpmH Large ribosomal subunit protein bL34 Wigglesworthia glossinidia brevipalpis
B2S0E3 8.41e-16 65 73 0 45 3 rpmH Large ribosomal subunit protein bL34 Borrelia hermsii (strain HS1 / DAH)
A9NE64 1.13e-15 65 75 0 44 3 rpmH Large ribosomal subunit protein bL34 Acholeplasma laidlawii (strain PG-8A)
C5BF63 1.39e-15 65 88 0 45 3 rpmH Large ribosomal subunit protein bL34 Edwardsiella ictaluri (strain 93-146)
Q661I1 1.56e-15 65 73 0 45 3 rpmH Large ribosomal subunit protein bL34 Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q0C551 1.72e-15 65 75 0 44 3 rpmH Large ribosomal subunit protein bL34 Hyphomonas neptunium (strain ATCC 15444)
C3LP80 2.03e-15 64 78 0 42 3 rpmH Large ribosomal subunit protein bL34 Vibrio cholerae serotype O1 (strain M66-2)
Q9KVY1 2.03e-15 64 78 0 42 3 rpmH Large ribosomal subunit protein bL34 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F482 2.03e-15 64 78 0 42 3 rpmH Large ribosomal subunit protein bL34 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B5EJJ2 2.05e-15 64 76 0 43 3 rpmH Large ribosomal subunit protein bL34 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J3D6 2.05e-15 64 76 0 43 3 rpmH Large ribosomal subunit protein bL34 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B7VGI0 2.88e-15 64 74 0 43 3 rpmH Large ribosomal subunit protein bL34 Vibrio atlanticus (strain LGP32)
C1CZV9 3.7e-15 64 68 0 45 3 rpmH Large ribosomal subunit protein bL34 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q0SN69 3.75e-15 64 71 0 45 3 rpmH Large ribosomal subunit protein bL34 Borreliella afzelii (strain PKo)
B7J206 4.93e-15 63 71 0 45 3 rpmH Large ribosomal subunit protein bL34 Borreliella burgdorferi (strain ZS7)
P29220 4.93e-15 63 71 0 45 1 rpmH Large ribosomal subunit protein bL34 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
A0M0A2 1.01e-14 63 71 0 45 3 rpmH Large ribosomal subunit protein bL34 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
B3EIN0 1.11e-14 63 75 0 45 3 rpmH Large ribosomal subunit protein bL34 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A6KXS6 1.19e-14 63 73 0 45 3 rpmH Large ribosomal subunit protein bL34 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q8F9L6 1.36e-14 62 68 0 45 3 rpmH Large ribosomal subunit protein bL34 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72VZ0 1.36e-14 62 68 0 45 3 rpmH Large ribosomal subunit protein bL34 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q64Z40 1.51e-14 62 73 0 45 3 rpmH Large ribosomal subunit protein bL34 Bacteroides fragilis (strain YCH46)
Q5LI34 1.51e-14 62 73 0 45 3 rpmH Large ribosomal subunit protein bL34 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q6YQX6 1.52e-14 62 70 0 44 3 rpmH Large ribosomal subunit protein bL34 Onion yellows phytoplasma (strain OY-M)
Q04XE0 1.62e-14 62 68 0 45 3 rpmH Large ribosomal subunit protein bL34 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04W32 1.62e-14 62 68 0 45 3 rpmH Large ribosomal subunit protein bL34 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q9RSH2 1.8e-14 62 68 0 45 1 rpmH Large ribosomal subunit protein bL34 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
C1D6I1 2.08e-14 62 68 0 44 3 rpmH Large ribosomal subunit protein bL34 Laribacter hongkongensis (strain HLHK9)
Q11YX6 2.59e-14 62 73 0 45 3 rpmH Large ribosomal subunit protein bL34 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
B3QYV9 2.71e-14 62 71 0 45 3 rpmH Large ribosomal subunit protein bL34 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
P33249 3.06e-14 62 72 0 43 3 rpmH Large ribosomal subunit protein bL34 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q2NJ02 3.2e-14 61 68 0 44 3 rpmH Large ribosomal subunit protein bL34 Aster yellows witches'-broom phytoplasma (strain AYWB)
Q9PPN5 3.41e-14 62 73 0 45 3 rpmH Large ribosomal subunit protein bL34 Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AJP5 3.41e-14 62 73 0 45 3 rpmH Large ribosomal subunit protein bL34 Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
B5ZCB9 3.72e-14 61 73 0 45 3 rpmH Large ribosomal subunit protein bL34 Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
A4W483 3.98e-14 61 71 0 45 3 rpmH Large ribosomal subunit protein bL34 Streptococcus suis (strain 98HAH33)
Q6F0D4 4.26e-14 61 68 0 44 3 rpmH Large ribosomal subunit protein bL34 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q8A1F6 4.39e-14 61 71 0 45 3 rpmH Large ribosomal subunit protein bL34 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B1VAN8 5.36e-14 61 68 0 44 3 rpmH Large ribosomal subunit protein bL34 Phytoplasma australiense
B6IPG6 6.05e-14 61 72 0 44 3 rpmH Large ribosomal subunit protein bL34 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q477Q1 6.53e-14 60 68 0 44 3 rpmH Large ribosomal subunit protein bL34 Dechloromonas aromatica (strain RCB)
Q1QS96 6.6e-14 60 93 0 31 3 rpmH Large ribosomal subunit protein bL34 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q7MWG1 6.73e-14 61 71 0 45 3 rpmH Large ribosomal subunit protein bL34 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RIL8 6.73e-14 61 71 0 45 3 rpmH Large ribosomal subunit protein bL34 Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q1LTW2 6.96e-14 60 82 0 45 3 rpmH Large ribosomal subunit protein bL34 Baumannia cicadellinicola subsp. Homalodisca coagulata
A8ILM7 8.05e-14 60 68 0 44 3 rpmH Large ribosomal subunit protein bL34 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B4S6X4 8.21e-14 60 71 0 45 3 rpmH Large ribosomal subunit protein bL34 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A0LE52 1.05e-13 60 73 0 42 3 rpmH Large ribosomal subunit protein bL34 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q058F8 1.66e-13 60 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
B3QZF8 1.94e-13 59 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Phytoplasma mali (strain AT)
Q3J6L6 2.03e-13 59 68 0 44 3 rpmH Large ribosomal subunit protein bL34 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
P78006 3.03e-13 59 66 0 45 1 rpmH Large ribosomal subunit protein bL34 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
B1LUP6 3.21e-13 59 68 0 44 3 rpmH Large ribosomal subunit protein bL34 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q4A912 3.38e-13 59 64 0 45 3 rpmH Large ribosomal subunit protein bL34 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q4A749 3.38e-13 59 64 0 45 3 rpmH Large ribosomal subunit protein bL34 Mesomycoplasma hyopneumoniae (strain 7448)
Q5ZZK9 3.38e-13 59 64 0 45 3 rpmH Large ribosomal subunit protein bL34 Mesomycoplasma hyopneumoniae (strain 232)
Q0AE59 3.39e-13 59 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
P47704 3.65e-13 59 66 0 45 3 rpmH Large ribosomal subunit protein bL34 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
A6T4E0 3.92e-13 58 69 0 42 3 rpmH Large ribosomal subunit protein bL34 Janthinobacterium sp. (strain Marseille)
A4GAN6 3.92e-13 58 69 0 42 3 rpmH Large ribosomal subunit protein bL34 Herminiimonas arsenicoxydans
B3PNJ7 4.55e-13 58 66 0 45 3 rpmH Large ribosomal subunit protein bL34 Metamycoplasma arthritidis (strain 158L3-1)
Q3SER0 4.88e-13 58 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Thiobacillus denitrificans (strain ATCC 25259)
B6YQA4 5.19e-13 58 66 0 45 3 rpmH Large ribosomal subunit protein bL34 Azobacteroides pseudotrichonymphae genomovar. CFP2
B4SPG2 5.37e-13 58 67 0 43 3 rpmH Large ribosomal subunit protein bL34 Stenotrophomonas maltophilia (strain R551-3)
Q602M9 5.75e-13 58 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B1XSP0 5.88e-13 58 68 0 44 3 rpmH Large ribosomal subunit protein bL34 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A4T0N5 5.88e-13 58 68 0 44 3 rpmH Large ribosomal subunit protein bL34 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q6MRS2 5.94e-13 58 67 0 43 3 rpmH Large ribosomal subunit protein bL34 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q2KD25 6.86e-13 58 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3Q042 6.86e-13 58 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Rhizobium etli (strain CIAT 652)
Q47U32 7.17e-13 58 87 0 31 3 rpmH Large ribosomal subunit protein bL34 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B5ZN44 7.24e-13 58 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A5G9V7 7.46e-13 58 64 0 45 3 rpmH Large ribosomal subunit protein bL34 Geotalea uraniireducens (strain Rf4)
Q3B107 7.55e-13 58 66 0 45 3 rpmH Large ribosomal subunit protein bL34 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q30T80 7.74e-13 58 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q3ANZ4 8.06e-13 58 68 0 45 3 rpmH Large ribosomal subunit protein bL34 Chlorobium chlorochromatii (strain CaD3)
Q7X5L3 9.85e-13 58 68 0 44 3 rpmH Large ribosomal subunit protein bL34 Thermus filiformis
B2FPA7 1e-12 58 65 0 43 3 rpmH Large ribosomal subunit protein bL34 Stenotrophomonas maltophilia (strain K279a)
Q98R56 1.25e-12 57 68 0 44 3 rpmH Large ribosomal subunit protein bL34 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q6KH13 1.4e-12 57 64 0 45 3 rpmH Large ribosomal subunit protein bL34 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
A8EY60 1.45e-12 57 68 0 44 3 rpmH Large ribosomal subunit protein bL34 Rickettsia canadensis (strain McKiel)
A1AV47 1.64e-12 57 68 0 44 3 rpmH Large ribosomal subunit protein bL34 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q82X98 1.73e-12 57 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A9IJC3 1.74e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q7VJX6 1.84e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A6QAL4 1.86e-12 57 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Sulfurovum sp. (strain NBC37-1)
B9KNZ1 1.86e-12 57 70 0 44 3 rpmH Large ribosomal subunit protein bL34 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A4WNL8 1.86e-12 57 70 0 44 3 rpmH Large ribosomal subunit protein bL34 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q3IYZ1 1.86e-12 57 70 0 44 3 rpmH Large ribosomal subunit protein bL34 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PNA6 1.86e-12 57 70 0 44 3 rpmH Large ribosomal subunit protein bL34 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A4ITX5 1.88e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Geobacillus thermodenitrificans (strain NG80-2)
A8EV99 2.01e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Aliarcobacter butzleri (strain RM4018)
A6U5L1 2.08e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Sinorhizobium medicae (strain WSM419)
Q92SF3 2.08e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Rhizobium meliloti (strain 1021)
Q0BU81 2.08e-12 57 67 0 43 3 rpmH Large ribosomal subunit protein bL34 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q8EKT9 2.1e-12 57 68 0 44 3 rpmH Large ribosomal subunit protein bL34 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B2U823 2.48e-12 57 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Ralstonia pickettii (strain 12J)
Q8Y3H9 2.48e-12 57 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2KTI8 2.48e-12 57 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Bordetella avium (strain 197N)
A7IGM5 2.53e-12 57 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A4J014 2.65e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NI53 2.65e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BNY4 2.65e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q422 2.65e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Francisella tularensis subsp. novicida (strain U112)
B2SE57 2.65e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A5N1 2.65e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Francisella tularensis subsp. holarctica (strain LVS)
A7N9L5 2.65e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14JK5 2.65e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Francisella tularensis subsp. tularensis (strain FSC 198)
B0TW70 2.65e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B1Z8E9 2.68e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A9W592 2.68e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Methylorubrum extorquens (strain PA1)
B7L2I7 2.68e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A8GP90 3.02e-12 57 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Rickettsia akari (strain Hartford)
P23376 3.3e-12 56 65 0 44 1 rpmH Large ribosomal subunit protein bL34 Geobacillus stearothermophilus
A4STS8 4.07e-12 56 81 0 44 3 rpmH Large ribosomal subunit protein bL34 Aeromonas salmonicida (strain A449)
A0KR00 4.07e-12 56 81 0 44 3 rpmH Large ribosomal subunit protein bL34 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q8DVX0 4.74e-12 56 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q13SH1 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Paraburkholderia xenovorans (strain LB400)
B2T7U4 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B2JJS1 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A4JJ49 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2STL7 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63YW4 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia pseudomallei (strain K96243)
A3N474 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia pseudomallei (strain 668)
A3NPW8 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia pseudomallei (strain 1106a)
Q1BSF4 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia orbicola (strain AU 1054)
B1K0Y7 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia orbicola (strain MC0-3)
A1V7D8 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia mallei (strain SAVP1)
Q62EM1 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia mallei (strain ATCC 23344)
A2S8D3 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia mallei (strain NCTC 10229)
A3MS23 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia mallei (strain NCTC 10247)
A9ACI3 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia multivorans (strain ATCC 17616 / 249)
Q39BP9 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BAP9 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E7D2 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0KBN6 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia cenocepacia (strain HI2424)
B1YQK0 4.79e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Burkholderia ambifaria (strain MC40-6)
Q7VSD9 4.85e-12 56 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2K4 4.85e-12 56 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WDJ8 4.85e-12 56 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A5G0F5 4.85e-12 56 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Acidiphilium cryptum (strain JF-5)
A1BK00 4.94e-12 56 66 0 45 3 rpmH Large ribosomal subunit protein bL34 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B3R886 4.95e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q46VL3 4.95e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0K5B8 4.95e-12 56 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q11LE7 5.18e-12 56 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Chelativorans sp. (strain BNC1)
A1KS01 6.1e-12 56 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66251 6.1e-12 56 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66250 6.1e-12 56 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B4RJJ6 6.1e-12 56 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Neisseria gonorrhoeae (strain NCCP11945)
Q5F4W2 6.1e-12 56 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q2RP15 6.38e-12 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B9DVU9 7.04e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
C0MF49 7.04e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U0T5 7.04e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M852 7.04e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus equi subsp. equi (strain 4047)
Q8DXQ6 7.04e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E3C5 7.04e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus agalactiae serotype III (strain NEM316)
Q3JZ91 7.04e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q5HUJ8 7.04e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Campylobacter jejuni (strain RM1221)
A1VZV2 7.04e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PNX4 7.04e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7H367 7.04e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FM15 7.04e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q5WAF9 7.11e-12 55 67 0 43 3 rpmH Large ribosomal subunit protein bL34 Shouchella clausii (strain KSM-K16)
Q1RI67 7.52e-12 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Rickettsia bellii (strain RML369-C)
A8GVL1 7.52e-12 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Rickettsia bellii (strain OSU 85-389)
Q121K8 7.69e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1VUS8 7.69e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Polaromonas naphthalenivorans (strain CJ2)
C5D9Z2 7.69e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Geobacillus sp. (strain WCH70)
B4SHH3 7.74e-12 55 64 0 45 3 rpmH Large ribosomal subunit protein bL34 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q98D90 8.03e-12 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A4SH23 8.36e-12 55 64 0 45 3 rpmH Large ribosomal subunit protein bL34 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B5XJP0 9.58e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE47 9.58e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VD7 9.58e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RCG1 9.58e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J8K6 9.58e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JIP8 9.58e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JNJ9 9.58e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JDM8 9.58e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66260 9.58e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XDY6 9.58e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE46 9.58e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66258 9.58e-12 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pyogenes serotype M1
Q032W9 1.02e-11 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Lactococcus lactis subsp. cremoris (strain SK11)
A2RHL6 1.02e-11 55 65 0 44 1 rpmH Large ribosomal subunit protein bL34 Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CJ70 1.02e-11 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Lactococcus lactis subsp. lactis (strain IL1403)
A8GSZ9 1.08e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Rickettsia rickettsii (strain Sheila Smith)
B0BUJ1 1.08e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Rickettsia rickettsii (strain Iowa)
A6Q3D1 1.13e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Nitratiruptor sp. (strain SB155-2)
Q5PA87 1.13e-11 55 65 0 43 3 rpmH Large ribosomal subunit protein bL34 Anaplasma marginale (strain St. Maries)
B9KJ41 1.13e-11 55 65 0 43 3 rpmH Large ribosomal subunit protein bL34 Anaplasma marginale (strain Florida)
Q5KU53 1.15e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Geobacillus kaustophilus (strain HTA426)
P66243 1.18e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Brucella suis biovar 1 (strain 1330)
A9WW32 1.18e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VVS7 1.18e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P66242 1.18e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RMG1 1.18e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Brucella melitensis biotype 2 (strain ATCC 23457)
A9MCU7 1.18e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q576U2 1.18e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Brucella abortus biovar 1 (strain 9-941)
Q2YJR4 1.18e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Brucella abortus (strain 2308)
A8LMA5 1.19e-11 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A1UTL8 1.32e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q8KGG5 1.46e-11 55 74 0 39 3 rpmH Large ribosomal subunit protein bL34 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q5LW05 1.49e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
C1CTP8 1.59e-11 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CMU0 1.59e-11 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pneumoniae (strain P1031)
C1CGS4 1.59e-11 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pneumoniae (strain JJA)
P66257 1.59e-11 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IMG7 1.59e-11 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pneumoniae (strain CGSP14)
P66256 1.59e-11 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZNZ8 1.59e-11 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I8U6 1.59e-11 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pneumoniae (strain Hungary19A-6)
C1CA38 1.59e-11 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pneumoniae (strain 70585)
B5E2I5 1.59e-11 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pneumoniae serotype 19F (strain G54)
Q04IH6 1.59e-11 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q03IQ3 1.6e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M2K7 1.6e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LY03 1.6e-11 55 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus thermophilus (strain CNRZ 1066)
B2GEU7 1.68e-11 55 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q7NC71 1.74e-11 55 64 0 45 3 rpmH Large ribosomal subunit protein bL34 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q2GL30 1.83e-11 54 65 0 43 3 rpmH Large ribosomal subunit protein bL34 Anaplasma phagocytophilum (strain HZ)
C4K1K9 1.85e-11 54 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Rickettsia peacockii (strain Rustic)
Q4UMK9 1.85e-11 54 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
C3PP51 1.85e-11 54 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Rickettsia africae (strain ESF-5)
Q9ZCU9 1.89e-11 54 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Rickettsia prowazekii (strain Madrid E)
Q5P4P1 2e-11 54 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q7NPQ5 2.23e-11 54 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q03UI8 2.26e-11 54 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B1MWS4 2.26e-11 54 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Leuconostoc citreum (strain KM20)
C4KZZ4 2.28e-11 54 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B3EQQ7 2.43e-11 54 62 0 45 3 rpmH Large ribosomal subunit protein bL34 Chlorobium phaeobacteroides (strain BS1)
Q7X5L7 2.74e-11 54 65 0 43 3 rpmH Large ribosomal subunit protein bL34 Thermus brockianus
Q1GJX0 2.75e-11 54 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Ruegeria sp. (strain TM1040)
Q03N60 2.81e-11 54 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A7ZAW5 2.94e-11 54 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P05647 2.94e-11 54 63 0 44 1 rpmH Large ribosomal subunit protein bL34 Bacillus subtilis (strain 168)
Q65CM7 2.94e-11 54 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A3CQP8 3.03e-11 54 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus sanguinis (strain SK36)
A8AUP4 3.39e-11 54 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q2GAV1 3.58e-11 54 65 0 44 3 rpmH Large ribosomal subunit protein bL34 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A1S1G8 3.65e-11 54 86 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A6WYM6 3.66e-11 53 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
C5CD39 4.04e-11 53 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
C4LEB8 4.31e-11 53 79 0 43 3 rpmH Large ribosomal subunit protein bL34 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
P80340 4.58e-11 53 62 0 45 1 rpmH Large ribosomal subunit protein bL34 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q16A96 4.66e-11 53 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q92H36 5.2e-11 53 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A0AMG5 5.2e-11 53 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P66248 5.2e-11 53 63 0 44 1 rpmH Large ribosomal subunit protein bL34 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DAR1 5.2e-11 53 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Listeria monocytogenes serotype 4a (strain HCC23)
Q71VQ6 5.2e-11 53 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Listeria monocytogenes serotype 4b (strain F2365)
P66249 5.2e-11 53 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A5VCE4 5.31e-11 53 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q2Y5A5 5.36e-11 53 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q7X5K9 5.59e-11 53 65 0 43 3 rpmH Large ribosomal subunit protein bL34 Thermus scotoductus
Q7X5L1 5.71e-11 53 65 0 43 3 rpmH Large ribosomal subunit protein bL34 Thermus oshimai
B9KFQ2 5.74e-11 53 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q9RCA3 5.79e-11 53 65 0 43 3 rpmH Large ribosomal subunit protein bL34 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A0RNF8 5.8e-11 53 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Campylobacter fetus subsp. fetus (strain 82-40)
B1Y0G0 6.77e-11 53 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q68WC9 8.62e-11 53 62 0 43 3 rpmH Large ribosomal subunit protein bL34 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A7I140 9e-11 53 61 0 42 3 rpmH Large ribosomal subunit protein bL34 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q73JL8 9.05e-11 53 64 0 45 3 rpmH Large ribosomal subunit protein bL34 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
B1KQ68 9.39e-11 53 83 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella woodyi (strain ATCC 51908 / MS32)
A7HPU1 9.62e-11 53 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q2VZ18 1.07e-10 52 62 0 43 3 rpmH Large ribosomal subunit protein bL34 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P66246 1.18e-10 52 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Helicobacter pylori (strain ATCC 700392 / 26695)
B2UVJ2 1.18e-10 52 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Helicobacter pylori (strain Shi470)
P66247 1.18e-10 52 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Helicobacter pylori (strain J99 / ATCC 700824)
Q1CRI2 1.18e-10 52 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Helicobacter pylori (strain HPAG1)
B1HPM8 1.32e-10 52 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Lysinibacillus sphaericus (strain C3-41)
B1YGB1 1.37e-10 52 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A8ZRZ2 1.37e-10 52 75 0 44 3 rpmH Large ribosomal subunit protein bL34 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
A6LNH1 1.43e-10 52 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q033K5 1.47e-10 52 66 0 42 3 rpmH Large ribosomal subunit protein bL34 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WBV7 1.47e-10 52 66 0 42 3 rpmH Large ribosomal subunit protein bL34 Lacticaseibacillus casei (strain BL23)
A7ZCY6 1.49e-10 52 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Campylobacter concisus (strain 13826)
B2GA54 1.54e-10 52 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VMV2 1.54e-10 52 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Limosilactobacillus reuteri (strain DSM 20016)
Q03D56 1.59e-10 52 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q21QM1 1.78e-10 52 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A9C1M4 2.24e-10 52 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q0ATU1 2.29e-10 52 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q82YU9 2.95e-10 52 66 0 39 1 rpmH Large ribosomal subunit protein bL34 Enterococcus faecalis (strain ATCC 700802 / V583)
Q8EKT3 3.01e-10 52 83 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
C0QIZ4 3.36e-10 51 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q49UI2 3.75e-10 51 60 0 43 3 rpmH Large ribosomal subunit protein bL34 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4L2Z0 3.75e-10 51 60 0 43 3 rpmH Large ribosomal subunit protein bL34 Staphylococcus haemolyticus (strain JCSC1435)
P66255 3.75e-10 51 60 0 43 3 rpmH Large ribosomal subunit protein bL34 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HS38 3.75e-10 51 60 0 43 3 rpmH Large ribosomal subunit protein bL34 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B9DI93 3.75e-10 51 60 0 43 3 rpmH Large ribosomal subunit protein bL34 Staphylococcus carnosus (strain TM300)
P66254 3.75e-10 51 60 0 43 3 rpmH Large ribosomal subunit protein bL34 Staphylococcus aureus (strain MW2)
A8YYS3 3.75e-10 51 60 0 43 3 rpmH Large ribosomal subunit protein bL34 Staphylococcus aureus (strain USA300 / TCH1516)
Q6G5W2 3.75e-10 51 60 0 43 3 rpmH Large ribosomal subunit protein bL34 Staphylococcus aureus (strain MSSA476)
Q6GD90 3.75e-10 51 60 0 43 3 rpmH Large ribosomal subunit protein bL34 Staphylococcus aureus (strain MRSA252)
P66253 3.75e-10 51 60 0 43 3 rpmH Large ribosomal subunit protein bL34 Staphylococcus aureus (strain N315)
P66252 3.75e-10 51 60 0 43 3 rpmH Large ribosomal subunit protein bL34 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QKK4 3.75e-10 51 60 0 43 3 rpmH Large ribosomal subunit protein bL34 Staphylococcus aureus (strain Newman)
Q5HCI1 3.75e-10 51 60 0 43 3 rpmH Large ribosomal subunit protein bL34 Staphylococcus aureus (strain COL)
Q2YZB6 3.75e-10 51 60 0 43 1 rpmH Large ribosomal subunit protein bL34 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FUQ0 3.75e-10 51 60 0 43 1 rpmH Large ribosomal subunit protein bL34 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FDE6 3.75e-10 51 60 0 43 3 rpmH Large ribosomal subunit protein bL34 Staphylococcus aureus (strain USA300)
A6U597 3.75e-10 51 60 0 43 3 rpmH Large ribosomal subunit protein bL34 Staphylococcus aureus (strain JH1)
A7X7B0 3.75e-10 51 60 0 43 3 rpmH Large ribosomal subunit protein bL34 Staphylococcus aureus (strain Mu3 / ATCC 700698)
A9G6E5 3.9e-10 51 61 0 42 3 rpmH Large ribosomal subunit protein bL34 Sorangium cellulosum (strain So ce56)
A9KLY4 3.97e-10 51 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A9VTM4 4.28e-10 51 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Bacillus mycoides (strain KBAB4)
Q630B4 4.28e-10 51 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Bacillus cereus (strain ZK / E33L)
Q814F2 4.28e-10 51 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IT46 4.28e-10 51 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Bacillus cereus (strain Q1)
A7GVQ1 4.28e-10 51 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7HZH4 4.28e-10 51 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Bacillus cereus (strain AH187)
B7H7A6 4.28e-10 51 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Bacillus cereus (strain B4264)
C1ER81 4.28e-10 51 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Bacillus cereus (strain 03BB102)
B7IST8 4.28e-10 51 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Bacillus cereus (strain G9842)
Q72WT9 4.28e-10 51 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JIL5 4.28e-10 51 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Bacillus cereus (strain AH820)
Q81JG9 4.28e-10 51 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Bacillus anthracis
C3LGU5 4.28e-10 51 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P3F9 4.28e-10 51 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Bacillus anthracis (strain A0248)
Q6A5A1 4.33e-10 51 59 0 44 1 rpmH Large ribosomal subunit protein bL34 Cutibacterium acnes (strain DSM 16379 / KPA171202)
B7IE38 4.38e-10 51 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Thermosipho africanus (strain TCF52B)
Q05HP6 5.32e-10 51 76 0 30 3 rpmH Large ribosomal subunit protein bL34 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SUW2 5.32e-10 51 76 0 30 3 rpmH Large ribosomal subunit protein bL34 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NX50 5.32e-10 51 76 0 30 3 rpmH Large ribosomal subunit protein bL34 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BLZ5 5.32e-10 51 76 0 30 3 rpmH Large ribosomal subunit protein bL34 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P66262 5.32e-10 51 76 0 30 3 rpmH Large ribosomal subunit protein bL34 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RMM8 5.32e-10 51 76 0 30 3 rpmH Large ribosomal subunit protein bL34 Xanthomonas campestris pv. campestris (strain B100)
Q4UNK6 5.32e-10 51 76 0 30 3 rpmH Large ribosomal subunit protein bL34 Xanthomonas campestris pv. campestris (strain 8004)
P66261 5.32e-10 51 76 0 30 3 rpmH Large ribosomal subunit protein bL34 Xanthomonas axonopodis pv. citri (strain 306)
A1RQF2 5.39e-10 51 83 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella sp. (strain W3-18-1)
Q0HPE3 5.39e-10 51 83 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella sp. (strain MR-7)
Q0HD61 5.39e-10 51 83 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella sp. (strain MR-4)
A8FP45 5.39e-10 51 83 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella sediminis (strain HAW-EB3)
A4YCM5 5.39e-10 51 83 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q07VS3 5.39e-10 51 83 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella frigidimarina (strain NCIMB 400)
Q12HM5 5.39e-10 51 83 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A9KX23 5.39e-10 51 83 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella baltica (strain OS195)
A6WUK7 5.39e-10 51 83 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella baltica (strain OS185)
A3DAT1 5.39e-10 51 83 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EDW8 5.39e-10 51 83 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella baltica (strain OS223)
Q1WRF8 5.58e-10 51 61 0 44 3 rpmH Large ribosomal subunit protein bL34 Ligilactobacillus salivarius (strain UCC118)
Q047F6 5.94e-10 51 62 0 43 3 rpmH Large ribosomal subunit protein bL34 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G7Z1 5.94e-10 51 62 0 43 3 rpmH Large ribosomal subunit protein bL34 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q04CX6 6.87e-10 50 62 0 43 3 rpmH Large ribosomal subunit protein bL34 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
B9L9D4 7.5e-10 50 70 0 31 3 rpmH Large ribosomal subunit protein bL34 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
A1WSU4 7.92e-10 50 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Verminephrobacter eiseniae (strain EF01-2)
A1TWI9 7.92e-10 50 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Paracidovorax citrulli (strain AAC00-1)
A1WDB9 7.92e-10 50 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Acidovorax sp. (strain JS42)
B9MJ02 7.92e-10 50 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Acidovorax ebreus (strain TPSY)
A1WWE1 9.32e-10 50 74 0 43 3 rpmH Large ribosomal subunit protein bL34 Halorhodospira halophila (strain DSM 244 / SL1)
Q38UE3 9.63e-10 50 64 0 42 3 rpmH Large ribosomal subunit protein bL34 Latilactobacillus sakei subsp. sakei (strain 23K)
B8CH70 1.14e-09 50 80 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella piezotolerans (strain WP3 / JCM 13877)
A8HAI3 1.14e-09 50 80 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A3QJT4 1.14e-09 50 80 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B0TQH4 1.14e-09 50 80 0 30 3 rpmH Large ribosomal subunit protein bL34 Shewanella halifaxensis (strain HAW-EB4)
A2SMJ2 1.33e-09 50 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A8F5C4 1.47e-09 50 59 0 44 3 rpmH Large ribosomal subunit protein bL34 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q8EU89 1.48e-09 50 55 0 45 3 rpmH Large ribosomal subunit protein bL34 Malacoplasma penetrans (strain HF-2)
B1LBK2 1.52e-09 50 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Thermotoga sp. (strain RQ2)
A5IMC1 1.52e-09 50 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
P58288 1.52e-09 50 63 0 44 3 rpmH Large ribosomal subunit protein bL34 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17570
Feature type CDS
Gene rpmH
Product 50S ribosomal protein L34
Location 148649 - 148789 (strand: -1)
Length 141 (nucleotides) / 46 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000007
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2123
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00468 Ribosomal protein L34

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0230 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L34

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02914 large subunit ribosomal protein L34 Ribosome -

Protein Sequence

MKRTFQPSVLKRNRSHGFRARMATKNGRQVLARRRAKSRTRLTVSK

Flanking regions ( +/- flanking 50bp)

TGACGCGTTTACTAAATCAGTAATAATTTAAAGCTTAGGTAGAAACCGCTATGAAACGCACTTTTCAACCGTCTGTACTGAAGCGTAACCGCTCCCATGGTTTCCGCGCTCGTATGGCAACTAAAAATGGTCGTCAGGTTCTGGCTCGCCGTCGTGCAAAAAGCCGTACTCGTCTGACTGTTTCTAAGTAATAAAGCTAACCATCTCACGTGGTCAAGCTAGCTTTTCCAAGGGAGTTACG