Homologs in group_1057

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05985 FBDBKF_05985 91.1 Morganella morganii S1 ispU (2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase
EHELCC_09030 EHELCC_09030 91.1 Morganella morganii S2 ispU (2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase
NLDBIP_09410 NLDBIP_09410 91.1 Morganella morganii S4 ispU (2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase
LHKJJB_08345 LHKJJB_08345 91.1 Morganella morganii S3 ispU (2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase
HKOGLL_07895 HKOGLL_07895 91.1 Morganella morganii S5 ispU (2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase
PMI_RS11260 PMI_RS11260 69.0 Proteus mirabilis HI4320 ispU (2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase

Distribution of the homologs in the orthogroup group_1057

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1057

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N8P2 5.86e-129 368 71 0 233 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q667J4 9.84e-128 365 71 1 243 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZH61 9.84e-128 365 71 1 243 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Yersinia pestis
Q6D8D8 7.88e-123 352 68 1 243 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P60475 4.1e-118 340 66 0 236 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Shigella flexneri
P60472 4.1e-118 340 66 0 236 1 ispU Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Escherichia coli (strain K12)
P60473 4.1e-118 340 66 0 236 1 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P60474 4.1e-118 340 66 0 236 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Escherichia coli O157:H7
Q8ZRP2 1.19e-114 332 67 0 234 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PD68 1.19e-114 332 67 0 234 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z9A5 6.5e-114 330 67 0 234 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Salmonella typhi
Q7VM20 6.76e-104 304 60 0 229 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9CJL4 8.38e-102 299 58 0 229 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Pasteurella multocida (strain Pm70)
P57330 7.9e-101 296 57 0 234 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8D2G7 1.72e-99 293 55 0 227 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Wigglesworthia glossinidia brevipalpis
Q7MIG4 2.1e-99 293 56 0 229 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Vibrio vulnificus (strain YJ016)
Q8DBF7 2.1e-99 293 56 0 229 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Vibrio vulnificus (strain CMCP6)
P44938 5.13e-99 291 56 0 229 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5E3E3 1.14e-96 286 56 0 229 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q87ME1 6.62e-94 279 56 0 229 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KPV6 2.59e-93 278 55 0 229 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8EGH1 2.92e-93 278 54 1 235 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7VRE1 3.02e-93 277 55 0 230 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Blochmanniella floridana
Q6LN28 7.34e-92 274 56 0 229 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Photobacterium profundum (strain SS9)
Q8K9S6 2.58e-88 265 53 0 233 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89AP0 3.65e-88 265 51 0 230 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9HXY2 1.54e-86 260 51 0 239 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q82TZ9 3.66e-86 260 50 2 240 3 uppS Isoprenyl transferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q88MH6 2.41e-84 255 51 1 241 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q886N9 2.21e-83 252 50 1 241 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q7NVZ0 1.62e-82 250 53 3 239 3 uppS Isoprenyl transferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q5F5X2 1.68e-82 250 50 2 241 3 uppS Isoprenyl transferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9JX35 2.28e-82 249 50 2 239 3 uppS Isoprenyl transferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9K1G6 1.6e-81 248 49 2 239 3 uppS Isoprenyl transferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q8RA26 7.61e-80 243 51 0 229 3 uppS Isoprenyl transferase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q5X7N9 7.68e-79 240 48 0 233 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Legionella pneumophila (strain Paris)
Q8XZI7 1.57e-78 240 48 2 242 3 uppS Isoprenyl transferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q5WZ40 5.59e-78 238 47 0 233 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Legionella pneumophila (strain Lens)
Q8XJQ9 7.88e-78 238 48 0 228 3 uppS Isoprenyl transferase Clostridium perfringens (strain 13 / Type A)
Q5ZY69 9.74e-78 238 47 0 233 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q83BV5 4.24e-77 236 49 1 233 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q8PMK9 4.77e-76 234 49 0 230 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Xanthomonas axonopodis pv. citri (strain 306)
Q8PAV7 1.07e-75 233 49 0 230 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q5H1E5 2.19e-75 232 49 0 230 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q8A1E0 7.65e-75 230 45 1 230 3 uppS Isoprenyl transferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q7VYC6 9.09e-74 228 48 3 249 3 uppS Isoprenyl transferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WA56 9.09e-74 228 48 3 249 3 uppS Isoprenyl transferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WJ90 9.09e-74 228 48 3 249 3 uppS Isoprenyl transferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8RE08 1.67e-72 224 46 2 233 3 uppS Isoprenyl transferase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5L0J8 2.82e-72 224 47 0 241 3 uppS Isoprenyl transferase Geobacillus kaustophilus (strain HTA426)
Q7MXJ4 5.38e-72 223 46 0 230 3 uppS Isoprenyl transferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q5NHX6 5.79e-72 223 43 2 242 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q87EH7 2.36e-71 222 45 0 229 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q895K8 3.61e-71 221 44 0 229 3 uppS Isoprenyl transferase Clostridium tetani (strain Massachusetts / E88)
Q9PEH8 3.69e-71 221 45 0 229 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Xylella fastidiosa (strain 9a5c)
Q8DRB3 5.84e-71 221 46 1 232 1 uppS Isoprenyl transferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97SR4 5.84e-71 221 46 1 232 1 uppS Isoprenyl transferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q6FCH1 1.69e-69 217 45 1 243 3 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q9KA67 1.85e-69 217 44 0 240 3 uppS Isoprenyl transferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8YRL4 3.35e-69 216 44 0 227 3 uppS2 Isoprenyl transferase 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q81WL2 8.34e-69 216 45 0 229 3 uppS Isoprenyl transferase Bacillus anthracis
Q9A707 1.08e-68 215 44 0 231 3 uppS Isoprenyl transferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q6HEZ2 1.11e-68 215 45 0 229 3 uppS Isoprenyl transferase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q92Q51 1.57e-68 214 47 0 230 3 uppS Isoprenyl transferase Rhizobium meliloti (strain 1021)
Q732P6 1.75e-68 215 45 0 229 3 uppS Isoprenyl transferase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q55482 1.93e-68 214 46 0 227 3 uppS Isoprenyl transferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8DXD5 2.73e-68 214 45 1 233 3 uppS Isoprenyl transferase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E359 3.51e-68 214 45 1 233 3 uppS Isoprenyl transferase Streptococcus agalactiae serotype III (strain NEM316)
Q8EQU9 6.86e-68 213 44 0 228 3 uppS Isoprenyl transferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8KFQ5 9.51e-68 213 43 0 230 3 uppS Isoprenyl transferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q7U7P7 9.91e-68 213 45 0 231 3 uppS Isoprenyl transferase Parasynechococcus marenigrum (strain WH8102)
Q4L5W2 1.06e-67 213 45 0 232 3 uppS Isoprenyl transferase Staphylococcus haemolyticus (strain JCSC1435)
Q8DSJ7 2.4e-67 211 46 1 233 3 uppS Isoprenyl transferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
O31751 2.5e-67 212 46 0 228 1 uppS Isoprenyl transferase Bacillus subtilis (strain 168)
Q819Y1 3.87e-67 211 45 0 229 3 uppS Isoprenyl transferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q49X45 1.19e-66 210 45 0 228 3 uppS Isoprenyl transferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8UFL9 1.24e-66 209 45 0 228 3 uppS Isoprenyl transferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9ZEJ7 1.27e-66 209 43 0 227 3 uppS Isoprenyl transferase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P58563 1.8e-66 209 43 0 227 3 uppS1 Isoprenyl transferase 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q92C39 3.39e-66 209 46 0 239 3 uppS Isoprenyl transferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q56Y11 4.08e-66 210 45 1 230 2 At5g58770 Dehydrodolichyl diphosphate synthase 2 Arabidopsis thaliana
Q831K9 5.4e-66 209 43 3 255 1 uppS Isoprenyl transferase Enterococcus faecalis (strain ATCC 700802 / V583)
K7X479 1.47e-65 209 43 1 232 1 CPT5 Dehydrodolichyl diphosphate synthase CPT5, chloroplastic Solanum lycopersicum
Q7UF53 1.57e-65 207 42 0 228 3 uppS Isoprenyl transferase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q5M677 1.67e-65 207 44 1 233 3 uppS Isoprenyl transferase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1N6 1.67e-65 207 44 1 233 3 uppS Isoprenyl transferase Streptococcus thermophilus (strain CNRZ 1066)
Q8GDY3 2.94e-65 206 43 0 229 3 uppS Isoprenyl transferase Heliobacterium mobile
Q8Y7G6 3.91e-65 206 44 0 239 3 uppS Isoprenyl transferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q7V6T7 3.98e-65 206 44 0 231 3 uppS Isoprenyl transferase Prochlorococcus marinus (strain MIT 9313)
P60477 5.26e-65 206 43 0 230 1 uppS Isoprenyl transferase Staphylococcus aureus (strain N315)
P60476 5.26e-65 206 43 0 230 3 uppS Isoprenyl transferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q720A7 5.36e-65 206 44 0 239 3 uppS Isoprenyl transferase Listeria monocytogenes serotype 4b (strain F2365)
Q8NWZ5 7.13e-65 205 43 0 230 3 uppS Isoprenyl transferase Staphylococcus aureus (strain MW2)
Q6G9V3 7.13e-65 205 43 0 230 3 uppS Isoprenyl transferase Staphylococcus aureus (strain MSSA476)
Q6GHH5 7.13e-65 205 43 0 230 3 uppS Isoprenyl transferase Staphylococcus aureus (strain MRSA252)
Q5HGH1 7.13e-65 205 43 0 230 3 uppS Isoprenyl transferase Staphylococcus aureus (strain COL)
Q9X5F1 8.42e-65 205 42 1 247 3 uppS Isoprenyl transferase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q8DI29 1.19e-64 205 44 0 227 3 uppS Isoprenyl transferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8G0D9 1.4e-64 204 44 0 231 3 uppS Isoprenyl transferase Brucella suis biovar 1 (strain 1330)
Q99XY1 1.49e-64 204 45 1 231 3 uppS Isoprenyl transferase Streptococcus pyogenes serotype M1
Q8NZB2 1.82e-64 204 45 1 231 3 uppS Isoprenyl transferase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9U4 1.82e-64 204 45 1 231 3 uppS Isoprenyl transferase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DH33 2.05e-64 204 45 1 231 3 uppS Isoprenyl transferase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DH32 2.05e-64 204 45 1 231 3 uppS Isoprenyl transferase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q7M7V7 2.23e-64 203 44 1 227 3 uppS Isoprenyl transferase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q8CPG7 2.35e-64 204 45 0 232 3 uppS Isoprenyl transferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPT1 2.35e-64 204 45 0 232 3 uppS Isoprenyl transferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q98MB9 3.48e-64 203 44 0 228 3 uppS Isoprenyl transferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q7V102 3.59e-64 204 42 0 228 3 uppS Isoprenyl transferase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
O82827 5.5e-64 203 39 0 239 1 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Micrococcus luteus
Q8YHH3 6.21e-64 203 44 0 231 3 uppS Isoprenyl transferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57CY1 6.21e-64 203 44 0 231 3 uppS Isoprenyl transferase Brucella abortus biovar 1 (strain 9-941)
Q7VBI9 1.46e-63 202 42 3 236 3 uppS Isoprenyl transferase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q88VJ8 1.6e-63 202 44 1 231 1 uppS Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q5WFT2 1.99e-63 202 44 0 228 3 uppS Isoprenyl transferase Shouchella clausii (strain KSM-K16)
Q7NPE7 6.98e-63 200 42 0 227 3 uppS Isoprenyl transferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q74IR9 2.42e-62 198 44 3 237 3 uppS Isoprenyl transferase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8GLK9 3.48e-62 197 45 2 227 3 uppS Isoprenyl transferase Aquifex pyrophilus
P60482 1.74e-61 196 41 0 230 3 uppS Isoprenyl transferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q7VH74 9.44e-61 194 43 3 235 3 uppS Isoprenyl transferase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
O67291 3.59e-60 192 44 2 227 3 uppS Isoprenyl transferase Aquifex aeolicus (strain VF5)
Q97I62 5.53e-60 193 40 1 232 3 uppS Isoprenyl transferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9X1B8 1.08e-59 191 42 1 228 3 uppS Isoprenyl transferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q68WV4 2.42e-59 190 42 1 226 3 uppS Isoprenyl transferase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q8F144 5.24e-59 190 37 1 231 3 uppS Isoprenyl transferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72U10 5.24e-59 190 37 1 231 3 uppS Isoprenyl transferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
K7W9N9 6.76e-59 191 43 2 232 1 CPT6 (2Z,6Z)-farnesyl diphosphate synthase CPT6, chloroplastic Solanum lycopersicum
K7WQ45 9.47e-59 192 43 3 236 1 CPT2 Nerylneryl diphosphate synthase CPT2, chloroplastic Solanum lycopersicum
Q5FJM7 1.04e-58 189 43 1 229 3 uppS Isoprenyl transferase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
C1K5M2 1.5e-58 191 42 2 230 1 CPT1 Dimethylallylcistransferase CPT1, chloroplastic Solanum lycopersicum
Q89KP7 1.86e-58 189 38 1 245 3 uppS2 Isoprenyl transferase 2 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9ZDA7 2.31e-58 188 41 1 226 3 uppS Isoprenyl transferase Rickettsia prowazekii (strain Madrid E)
Q9CDT1 9.72e-58 187 40 3 237 3 uppS Isoprenyl transferase Lactococcus lactis subsp. lactis (strain IL1403)
P55984 1.41e-57 186 39 1 226 1 uppS Isoprenyl transferase Helicobacter pylori (strain ATCC 700392 / 26695)
Q4ULR6 1.88e-57 186 41 1 226 3 uppS Isoprenyl transferase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
O84456 2.99e-57 186 40 1 231 3 uppS Isoprenyl transferase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q7PBU9 3.19e-57 185 40 1 226 3 uppS Isoprenyl transferase Rickettsia sibirica (strain ATCC VR-151 / 246)
Q9ZK05 3.99e-57 185 39 1 226 3 uppS Isoprenyl transferase Helicobacter pylori (strain J99 / ATCC 700824)
Q92I30 4.43e-57 185 40 1 226 3 uppS Isoprenyl transferase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
B8XA40 5.57e-57 187 42 2 230 1 ZFPS (2Z,6Z)-farnesyl diphosphate synthase, chloroplastic Solanum habrochaites
Q9Z7Y7 6.8e-57 185 38 3 249 3 uppS Isoprenyl transferase Chlamydia pneumoniae
Q9L2H4 1.32e-56 185 39 0 234 3 uppS1 Isoprenyl transferase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9PJU2 3.28e-56 183 39 1 235 3 uppS Isoprenyl transferase Chlamydia muridarum (strain MoPn / Nigg)
Q8GY03 4.08e-56 184 39 1 229 2 At5g58782 Dehydrodolichyl diphosphate synthase 4 Arabidopsis thaliana
Q89W41 4.29e-56 182 44 2 236 3 uppS1 Isoprenyl transferase 1 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1RII8 6.23e-56 182 41 1 226 3 uppS Isoprenyl transferase Rickettsia bellii (strain RML369-C)
Q82BS5 6.82e-56 183 37 1 247 3 uppS2 Isoprenyl transferase 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
K4D3U9 1.26e-55 183 41 1 221 2 CPT4 Cis-prenyltransferase 4, chloroplastic Solanum lycopersicum
K4CA50 1.93e-55 182 41 3 235 2 CPT7 Cis-prenyltransferase 7, chloroplastic Solanum lycopersicum
Q824H0 3.74e-55 180 40 2 238 3 uppS Isoprenyl transferase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q8RX73 4.66e-55 182 38 1 241 2 At5g58780 Dehydrodolichyl diphosphate synthase 3 Arabidopsis thaliana
Q8U0I8 8.04e-55 180 41 1 229 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O83612 9.84e-55 179 40 2 229 3 uppS Isoprenyl transferase Treponema pallidum (strain Nichols)
Q9V157 1.39e-54 179 41 1 229 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Pyrococcus abyssi (strain GE5 / Orsay)
A8B1Z2 2.33e-54 179 39 4 241 1 UPPS Di-trans,poly-cis-undecaprenyl-diphosphate synthase Giardia intestinalis (strain ATCC 50803 / WB clone C6)
Q58767 3.15e-54 179 41 3 240 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q5JGE1 5.74e-54 178 39 1 229 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q47RM6 7.09e-54 178 40 0 232 1 Tfu_0853 Trans,polycis-polyprenyl diphosphate synthase ((2Z,6E)-farnesyl diphosphate specific) Thermobifida fusca (strain YX)
Q5SH15 1.95e-52 174 38 2 235 3 uppS Isoprenyl transferase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P9WFF7 1.98e-52 175 39 0 227 1 uppS Decaprenyl diphosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFF6 1.98e-52 175 39 0 227 3 uppS Decaprenyl diphosphate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P60478 1.98e-52 175 39 0 227 3 uppS Decaprenyl diphosphate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O87197 2.13e-52 174 38 2 235 3 uppS Isoprenyl transferase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q5L6U0 2.33e-52 173 40 2 231 3 uppS Isoprenyl transferase Chlamydia abortus (strain DSM 27085 / S26/3)
Q570Q8 2.57e-52 175 40 1 221 2 At5g58784 Dehydrodolichyl diphosphate synthase 5 Arabidopsis thaliana
O59258 2.99e-52 173 40 1 229 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
O80458 6.74e-52 174 37 2 230 1 DPS Dehydrodolichyl diphosphate synthase 1 Arabidopsis thaliana
Q73K76 2.1e-51 170 40 2 226 3 uppS Isoprenyl transferase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q5HUX2 3.32e-51 169 37 2 226 3 uppS Isoprenyl transferase Campylobacter jejuni (strain RM1221)
Q9PP99 3.32e-51 169 37 2 226 1 uppS Isoprenyl transferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q93AU4 3.51e-51 172 37 1 241 3 uppS Isoprenyl transferase Mycolicibacterium parafortuitum
Q83HN8 4.61e-51 170 39 2 231 3 uppS2 Isoprenyl transferase 2 Tropheryma whipplei (strain TW08/27)
Q83GJ0 4.61e-51 170 39 2 231 3 uppS1 Isoprenyl transferase 1 Tropheryma whipplei (strain Twist)
P38119 6.21e-51 171 39 0 227 3 uppS Decaprenyl diphosphate synthase Mycobacterium leprae (strain TN)
Q9HKQ0 5.5e-50 167 36 2 245 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q8NNC1 6.42e-50 167 37 0 227 3 uppS2 Isoprenyl transferase 2 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8FNG2 9.07e-50 166 36 0 227 3 uppS2 Isoprenyl transferase 2 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q97B58 1.8e-49 166 36 2 242 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
O51146 2.45e-49 165 36 1 227 3 uppS Isoprenyl transferase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
O26334 3.13e-49 165 37 4 241 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8TXA7 1.8e-48 164 34 1 240 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q6KZ89 2.62e-48 163 35 2 239 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
A0R0S4 3.4e-48 164 37 0 227 1 uppS Decaprenyl diphosphate synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P60481 7.84e-48 161 36 0 229 3 uppS2 Isoprenyl transferase 2 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q8G7Y3 8.14e-47 159 36 0 229 3 uppS Isoprenyl transferase Bifidobacterium longum (strain NCC 2705)
Q47SS3 8.44e-46 156 35 3 237 1 Tfu_0456 (2Z,6E)-farnesyl diphosphate synthase Thermobifida fusca (strain YX)
Q9ACU1 5.8e-44 159 38 1 241 3 crtB/uppS3 Bifunctional protein CrtB/UppS Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8PZ76 7.32e-43 150 36 3 230 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P60480 7.8e-43 149 36 4 232 3 uppS1 Isoprenyl transferase 1 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q82IC1 2.03e-42 148 31 4 232 3 uppS1 Isoprenyl transferase 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8TJQ7 3.1e-42 149 36 5 235 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q976K2 4.01e-42 147 32 2 233 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q8FQR4 2.14e-41 145 36 4 239 3 uppS1 Isoprenyl transferase 1 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q9HH76 4.1e-41 145 32 2 236 1 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (GGDP specific) Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
P20182 4.74e-40 142 35 7 245 3 uppS Isoprenyl transferase Streptomyces fradiae
Q8ZU54 6.42e-40 141 34 4 232 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q99KU1 2.71e-39 142 35 2 233 1 Dhdds Dehydrodolichyl diphosphate synthase complex subunit Dhdds Mus musculus
P38118 4.68e-39 138 34 3 226 3 uppS1 Isoprenyl transferase 1 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q9RRP1 1.26e-38 139 33 3 237 3 uppS Isoprenyl transferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q980W4 2.28e-38 137 31 2 235 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
O14171 3.3e-38 137 31 2 216 1 SPAC4D7.04c Dehydrodolichyl diphosphate synthase complex subunit SPAC4D7.04c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q86SQ9 3.41e-38 139 34 1 224 1 DHDDS Dehydrodolichyl diphosphate synthase complex subunit DHDDS Homo sapiens
A0R2W4 8.87e-38 136 34 5 233 1 uppS (2Z,6E)-farnesyl diphosphate synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9CB36 1.34e-37 135 33 4 239 3 ML2467 Short-chain Z-isoprenyl diphosphate synthase Mycobacterium leprae (strain TN)
O29049 1.67e-37 135 34 2 226 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9XA06 2.23e-37 135 32 5 236 3 uppS2 Isoprenyl transferase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9HP68 7.67e-37 135 33 4 229 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q7U0P8 1.84e-35 130 33 5 240 3 BQ2027_MB1115 Short-chain Z-isoprenyl diphosphate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q5V1I1 4.34e-35 130 35 7 232 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P9WFF5 1.36e-34 128 33 5 240 1 Rv1086 (2Z,6E)-farnesyl diphosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFF4 1.36e-34 128 33 5 240 3 MT1118 (2Z,6E)-farnesyl diphosphate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q03175 1.02e-30 119 31 3 216 1 SRT1 Dehydrodolichyl diphosphate synthase complex subunit SRT1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
K7WCI9 6.97e-30 116 30 3 233 1 CPT3 Dehydrodolichyl diphosphate synthase CPT3 Solanum lycopersicum
Q8S2T1 1.54e-29 115 30 4 236 2 At2g17570 Dehydrodolichyl diphosphate synthase 6 Arabidopsis thaliana
Q83HR7 3.86e-29 113 32 8 236 3 uppS1 Isoprenyl transferase 1 Tropheryma whipplei (strain TW08/27)
Q83GG2 8.7e-29 112 33 8 236 3 uppS2 Isoprenyl transferase 2 Tropheryma whipplei (strain Twist)
P35196 3.71e-28 111 34 4 212 1 RER2 Dehydrodolichyl diphosphate synthase complex subunit RER2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8LAR7 1.26e-27 110 32 6 217 2 At5g60510 Dehydrodolichyl diphosphate synthase 8 Arabidopsis thaliana
Q8LED0 1.57e-27 109 31 6 216 2 At5g60500 Dehydrodolichyl diphosphate synthase 7 Arabidopsis thaliana
Q8W3U4 2.85e-24 101 27 4 231 1 HRT2 Rubber cis-polyprenyltransferase HRT2 Hevea brasiliensis
Q9YC66 1.5e-21 92 29 5 230 3 uppS Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q8SQJ8 7.51e-10 61 22 5 209 1 RER2 Dehydrodolichyl diphosphate synthase Encephalitozoon cuniculi (strain GB-M1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS15910
Feature type CDS
Gene uppS
Product polyprenyl diphosphate synthase
Location 189274 - 190047 (strand: 1)
Length 774 (nucleotides) / 257 (amino acids)

Contig

Accession term accessions NZ_VXKB01000005 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 213534 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1057
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01255 Putative undecaprenyl diphosphate synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0020 Lipid transport and metabolism (I) I Undecaprenyl pyrophosphate synthase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00806 undecaprenyl diphosphate synthase [EC:2.5.1.31] Peptidoglycan biosynthesis
Terpenoid backbone biosynthesis
Biosynthesis of secondary metabolites
-

Protein Sequence

MTVSSENASDKPGPQHVAIIMDGNGRWAKKRGKLRVSGHRAGIKSVRSSVSFAIKHQIKSLTLYAFSSENWNRPEQEVHSLMELFVFALDNEVKSLHKHNVRLSVIGDVSRFSPRLQERIRRGQVLTAGNTGLQLNIAANYGGRWDIANSMKQVIAEVQRGELALEDVSELDINRYISLHEQPAIDLVIRTGGEHRISNFLLWQVAYAEFYFTEVLWPDFNETAFGDAVTAFTQRERRFGGTTPDEHSEQTPGGYVA

Flanking regions ( +/- flanking 50bp)

TTTTGTGTCAGACGCCCTGCATTAGCCGATATCTCAAAGGATTAACTTGCGTGACAGTATCCAGTGAAAATGCCTCAGATAAGCCGGGACCACAGCATGTCGCCATTATTATGGACGGCAACGGCCGCTGGGCAAAAAAACGCGGAAAACTGCGTGTTTCCGGCCACCGCGCAGGGATCAAATCAGTCCGCAGCTCTGTCAGTTTTGCAATCAAACATCAGATAAAATCGCTGACACTTTATGCTTTCAGCAGTGAAAACTGGAACCGTCCCGAACAGGAAGTCCATTCACTGATGGAATTGTTTGTCTTTGCGCTGGATAATGAAGTAAAAAGTCTGCATAAACACAATGTCAGACTGTCCGTTATTGGTGATGTCAGCCGCTTCAGTCCGCGTTTGCAGGAACGGATCCGCCGCGGGCAGGTTCTGACTGCCGGCAATACCGGATTACAACTTAATATTGCCGCCAATTATGGCGGGCGCTGGGATATTGCCAACAGTATGAAGCAGGTCATCGCAGAAGTTCAGCGCGGTGAACTGGCACTTGAAGATGTCAGCGAGCTGGACATCAACCGTTATATTTCTCTCCATGAACAGCCTGCTATCGATTTAGTTATCCGGACCGGTGGCGAGCATCGTATCAGTAACTTCCTGCTTTGGCAGGTGGCGTACGCGGAGTTTTATTTTACTGAGGTTCTGTGGCCGGATTTTAATGAAACAGCGTTTGGTGATGCTGTGACGGCCTTTACTCAGCGTGAGCGTCGCTTCGGCGGAACCACGCCGGACGAACATTCTGAGCAAACACCGGGAGGATACGTTGCTTAAATACCGCCTTATTACTGCCATTATTTTAATTCCGCTGGTCATTCTGGCGC