Homologs in group_1067

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06045 FBDBKF_06045 81.9 Morganella morganii S1 fldA flavodoxin
EHELCC_09090 EHELCC_09090 81.9 Morganella morganii S2 fldA flavodoxin
NLDBIP_09470 NLDBIP_09470 81.9 Morganella morganii S4 fldA flavodoxin
LHKJJB_08285 LHKJJB_08285 81.9 Morganella morganii S3 fldA flavodoxin
HKOGLL_07835 HKOGLL_07835 81.9 Morganella morganii S5 fldA flavodoxin
PMI_RS11310 PMI_RS11310 61.9 Proteus mirabilis HI4320 - flavodoxin

Distribution of the homologs in the orthogroup group_1067

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1067

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P65369 8.55e-63 192 61 0 144 3 yqcA Uncharacterized protein YqcA Shigella flexneri
P65367 8.55e-63 192 61 0 144 1 yqcA Flavodoxin YqcA Escherichia coli (strain K12)
P65368 8.55e-63 192 61 0 144 3 yqcA Uncharacterized protein YqcA Escherichia coli O157:H7
Q47418 1.49e-52 166 55 0 145 3 None Flavodoxin YqcA Pectobacterium carotovorum subsp. carotovorum
Q9HYH1 1.3e-30 110 39 1 148 1 PA3435 Uncharacterized protein PA3435 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KVY6 4.61e-21 86 34 1 138 3 mioC Protein MioC homolog Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P03817 1.39e-17 77 30 1 149 1 mioC Protein MioC Escherichia coli (strain K12)
P44813 1.66e-17 77 31 1 147 3 mioC Protein MioC homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P58208 2e-17 77 30 1 149 3 mioC Protein MioC Escherichia coli O157:H7
Q9L6A2 1.18e-16 74 31 2 150 3 mioC Protein MioC homolog Pasteurella multocida (strain Pm70)
Q9KUX4 3.03e-12 66 34 5 150 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3I4 3.06e-12 66 34 5 150 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P52674 5.45e-12 65 34 1 118 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Thiocapsa roseopersicina
Q4JIJ2 8.57e-12 65 34 3 123 2 MTRR Methionine synthase reductase Bos taurus
Q8C1A3 2.38e-11 63 35 3 123 1 Mtrr Methionine synthase reductase Mus musculus
Q9UBK8 1.52e-10 61 34 3 122 1 MTRR Methionine synthase reductase Homo sapiens
Q2NVN4 3.39e-10 60 32 1 124 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Sodalis glossinidius (strain morsitans)
O32214 4.44e-10 60 29 1 124 1 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Bacillus subtilis (strain 168)
Q8DCK2 5.23e-09 57 31 1 110 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Vibrio vulnificus (strain CMCP6)
Q7MHA5 5.33e-09 57 31 1 110 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Vibrio vulnificus (strain YJ016)
P19618 1.29e-08 55 26 3 156 1 por NADPH--cytochrome P450 reductase (Fragments) Salmo trutta
Q87L90 1.57e-08 55 30 2 136 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q5E841 1.67e-08 55 31 1 125 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q498R1 2.68e-08 55 32 3 122 2 Mtrr Methionine synthase reductase Rattus norvegicus
Q968X7 6.92e-08 53 26 2 148 2 PFOR Pyruvate dehydrogenase [NADP(+)] Cryptosporidium parvum
A9LZ73 1.13e-07 53 30 4 126 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Neisseria meningitidis serogroup C (strain 053442)
Q9JUD8 1.22e-07 53 30 4 126 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q7VQH2 1.41e-07 52 28 1 115 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Blochmanniella floridana
Q9JS45 2.03e-07 52 30 4 129 3 cysJ1 Sulfite reductase [NADPH] flavoprotein alpha-component Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1KU06 2.27e-07 52 30 4 126 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q54B10 3.99e-07 51 27 1 128 2 redA NADPH oxidoreductase A Dictyostelium discoideum
P38039 8.13e-07 50 28 5 151 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P50126 1.38e-06 50 32 0 71 2 NCP1 NADPH--cytochrome P450 reductase Candida maltosa
P37039 2.04e-06 49 25 3 156 2 Por NADPH--cytochrome P450 reductase Cavia porcellus
Q6LM58 2.83e-06 48 32 2 120 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Photobacterium profundum (strain SS9)
P00389 3.2e-06 48 25 3 156 1 POR NADPH--cytochrome P450 reductase Oryctolagus cuniculus
Q32CG3 3.42e-06 48 27 3 149 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shigella dysenteriae serotype 1 (strain Sd197)
A8A3P5 4.26e-06 48 28 4 151 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli O9:H4 (strain HS)
Q8X7U1 4.51e-06 48 29 5 151 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli O157:H7
Q65T53 5.16e-06 48 27 3 120 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q653S9 5.4e-06 48 31 4 128 1 CPR3 NADPH--cytochrome P450 reductase 3 Oryza sativa subsp. japonica
P38038 5.73e-06 48 29 5 151 1 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli (strain K12)
Q3YY94 5.9e-06 48 29 5 151 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shigella sonnei (strain Ss046)
B1IU77 6.19e-06 48 29 5 151 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZQK7 6.19e-06 48 29 5 151 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli O139:H28 (strain E24377A / ETEC)
Q31XM4 6.55e-06 48 29 5 151 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shigella boydii serotype 4 (strain Sb227)
Q8FEI7 6.81e-06 48 29 5 151 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q1R7T4 7.01e-06 47 29 5 151 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli (strain UTI89 / UPEC)
Q0TEA2 7.01e-06 47 29 5 151 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AEV0 7.01e-06 47 29 5 151 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli O1:K1 / APEC
Q1LTP1 7.21e-06 47 41 1 68 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Baumannia cicadellinicola subsp. Homalodisca coagulata
Q0HYB4 8.1e-06 47 30 1 109 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shewanella sp. (strain MR-7)
P37201 8.65e-06 47 31 2 91 3 NCP1 NADPH--cytochrome P450 reductase Candida tropicalis
P04175 8.98e-06 47 24 3 156 1 POR NADPH--cytochrome P450 reductase Sus scrofa
Q83QD9 9.16e-06 47 29 5 151 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shigella flexneri
Q0T1I8 9.16e-06 47 29 5 151 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shigella flexneri serotype 5b (strain 8401)
Q3SYT8 1.08e-05 47 25 3 156 2 POR NADPH--cytochrome P450 reductase Bos taurus
Q5NRM1 1.11e-05 47 29 5 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q57KH7 1.55e-05 47 27 5 151 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Salmonella choleraesuis (strain SC-B67)
Q0HFL6 1.55e-05 47 29 1 109 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shewanella sp. (strain MR-4)
A9N2E6 1.6e-05 47 27 5 151 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
A0KTH4 1.63e-05 47 29 1 109 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shewanella sp. (strain ANA-3)
Q5PEH7 1.91e-05 46 26 4 149 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A1JJS2 2.07e-05 46 25 1 124 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P37040 2.19e-05 46 23 3 156 1 Por NADPH--cytochrome P450 reductase Mus musculus
P00388 2.34e-05 46 23 3 156 1 Por NADPH--cytochrome P450 reductase Rattus norvegicus
Q8EAZ9 2.46e-05 46 29 1 109 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7N8L6 2.86e-05 46 27 3 127 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6TD49 3.17e-05 45 28 4 148 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q9SUM3 3.19e-05 46 29 4 148 1 ATR2 NADPH--cytochrome P450 reductase 2 Arabidopsis thaliana
Q8Z458 4.19e-05 45 27 5 151 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Salmonella typhi
P16603 5.08e-05 45 30 4 99 1 NCP1 NADPH--cytochrome P450 reductase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A7MJ63 6.88e-05 45 28 2 119 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Cronobacter sakazakii (strain ATCC BAA-894)
O94613 0.000121 44 28 4 121 3 tah18 NADPH-dependent diflavin oxidoreductase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P16435 0.000237 43 23 3 156 1 POR NADPH--cytochrome P450 reductase Homo sapiens
A9MF16 0.000245 43 26 4 148 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8G9X6 0.000463 42 29 4 131 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Serratia proteamaculans (strain 568)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS15860
Feature type CDS
Gene -
Product flavodoxin
Location 178487 - 178936 (strand: 1)
Length 450 (nucleotides) / 149 (amino acids)

Contig

Accession term accessions NZ_VXKB01000005 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 213534 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1067
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00258 Flavodoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0369 Nucleotide transport and metabolism (F)
Inorganic ion transport and metabolism (P)		 FP Flavoprotein (flavin reductase) subunit CysJ of sulfite and N-hydroxylaminopurine reductases

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06205 MioC protein - -

Protein Sequence

MARIGIFVGTVYGNSLAVGEEAQAVLTDAGHDVTLFDEPELAQWKAYLTDVALVITSTTGQGDLPDNIRALFAGLRDEVGYQPSLRYGIIALGDSSYDNFAGGGQQFDELLQEQQAQRIGEMLVIDGADVAVPEEHALAWITEWAAQIK

Flanking regions ( +/- flanking 50bp)

AGTATAACAATATGATCTTTATAATTAAATCTGACTGAAAAGGACAAGTGATGGCGCGTATCGGTATTTTTGTCGGCACAGTGTATGGCAATTCTCTGGCTGTGGGTGAAGAAGCACAGGCTGTTCTGACGGACGCCGGTCATGATGTGACATTATTTGATGAACCGGAACTTGCACAGTGGAAAGCGTATCTTACGGATGTGGCGCTGGTGATTACCTCTACGACCGGGCAGGGCGATTTGCCGGATAATATCCGTGCGCTGTTTGCCGGGCTGCGTGATGAGGTAGGCTATCAGCCATCCCTGCGTTACGGCATTATCGCGCTGGGTGACAGCAGTTATGATAACTTTGCCGGTGGTGGTCAGCAGTTTGATGAATTGTTGCAAGAGCAACAGGCGCAGCGCATTGGTGAGATGCTGGTGATTGATGGCGCAGACGTTGCCGTGCCTGAAGAGCATGCATTGGCGTGGATAACTGAGTGGGCAGCGCAGATTAAGTAACAGTAAAAACAGCGCCGTTATAAGCCGGTATGGCACAACGGCGCAGTATA