Homologs in group_1667

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10710 FBDBKF_10710 85.2 Morganella morganii S1 bioH pimeloyl-ACP methyl ester esterase BioH
EHELCC_15045 EHELCC_15045 85.2 Morganella morganii S2 bioH pimeloyl-ACP methyl ester esterase BioH
NLDBIP_14875 NLDBIP_14875 85.2 Morganella morganii S4 bioH pimeloyl-ACP methyl ester esterase BioH
LHKJJB_14470 LHKJJB_14470 85.2 Morganella morganii S3 bioH pimeloyl-ACP methyl ester esterase BioH
HKOGLL_13090 HKOGLL_13090 85.2 Morganella morganii S5 bioH pimeloyl-ACP methyl ester esterase BioH
PMI_RS14455 PMI_RS14455 63.9 Proteus mirabilis HI4320 bioH pimeloyl-ACP methyl ester esterase BioH

Distribution of the homologs in the orthogroup group_1667

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1667

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N9V7 2.36e-121 349 66 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DGH6 2.8e-120 346 66 1 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A8AQW5 7.08e-119 343 64 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8GKT5 1.18e-117 340 65 1 255 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Serratia proteamaculans (strain 568)
Q8GHL1 1.53e-117 339 65 2 255 1 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Serratia marcescens
B7LSB5 1.05e-116 337 62 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B4EZM6 1.79e-116 337 64 2 253 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Proteus mirabilis (strain HI4320)
Q8Z221 4e-116 335 64 1 252 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella typhi
B5BHG7 4e-116 335 64 1 252 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella paratyphi A (strain AKU_12601)
C0Q0I5 4e-116 335 64 1 252 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella paratyphi C (strain RKS4594)
Q5PLY8 4e-116 335 64 1 252 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5R7K5 4e-116 335 64 1 252 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R369 4e-116 335 64 1 252 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella enteritidis PT4 (strain P125109)
Q57IW5 4e-116 335 64 1 252 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella choleraesuis (strain SC-B67)
B4SVL3 6.61e-116 335 63 1 252 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella newport (strain SL254)
Q8FCT4 7.46e-116 335 62 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B1LHL2 1.52e-115 334 62 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli (strain SMS-3-5 / SECEC)
Q8ZLI9 2.18e-115 334 63 1 252 1 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TKT6 2.18e-115 334 63 1 252 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella heidelberg (strain SL476)
B5FJT1 2.18e-115 334 63 1 252 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella dublin (strain CT_02021853)
B5F8M6 4.07e-115 333 63 1 252 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella agona (strain SL483)
Q6CZL9 4.33e-115 333 64 1 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B7NE17 5.06e-115 333 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NMH7 5.06e-115 333 62 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A1JSF8 5.79e-115 333 62 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P13001 6.03e-115 333 61 1 257 1 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli (strain K12)
B1X758 6.03e-115 333 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli (strain K12 / DH10B)
C4ZUR7 6.03e-115 333 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli (strain K12 / MC4100 / BW2952)
Q83PW0 6.72e-115 333 61 1 257 1 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Shigella flexneri
B6I2X6 8.75e-115 332 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli (strain SE11)
B1IP53 8.75e-115 332 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A5M0 8.75e-115 332 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli O9:H4 (strain HS)
B7M1W8 8.75e-115 332 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli O8 (strain IAI1)
Q31VM0 1.02e-114 332 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Shigella boydii serotype 4 (strain Sb227)
Q3YWL3 1.21e-114 332 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Shigella sonnei (strain Ss046)
B2U3M2 1.21e-114 332 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7N145 2.39e-114 331 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli O81 (strain ED1a)
A7ZSU1 2.64e-114 331 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7UKB7 2.82e-114 331 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7L4T9 3.08e-114 331 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli (strain 55989 / EAEC)
Q664J8 4.24e-114 330 62 1 256 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K5V7 4.24e-114 330 62 1 256 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B1JHZ5 1.94e-113 329 61 1 256 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A9R4D0 1.94e-113 329 61 1 256 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Yersinia pestis bv. Antiqua (strain Angola)
Q74Y45 1.94e-113 329 61 1 256 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Yersinia pestis
A7FNV8 1.94e-113 329 61 1 256 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B5YTW3 2.84e-113 328 62 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X716 2.84e-113 328 62 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli O157:H7
Q0TC55 3.81e-113 328 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A9MMB5 4.16e-113 328 63 1 251 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q1R5M2 6.96e-113 327 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli (strain UTI89 / UPEC)
A1AGT6 6.96e-113 327 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli O1:K1 / APEC
B7MDN8 6.96e-113 327 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q32AM6 1.11e-112 327 61 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Shigella dysenteriae serotype 1 (strain Sd197)
A7MGD2 4.25e-110 320 62 1 249 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Cronobacter sakazakii (strain ATCC BAA-894)
C5BGT3 6.04e-107 312 62 1 256 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Edwardsiella ictaluri (strain 93-146)
A6TF35 1.63e-106 311 59 1 257 1 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XTS4 1.36e-105 309 59 1 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Klebsiella pneumoniae (strain 342)
Q2NQH6 3.55e-100 295 59 1 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Sodalis glossinidius (strain morsitans)
B5FFE9 5.98e-90 269 50 2 255 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Aliivibrio fischeri (strain MJ11)
Q5E8N3 1.3e-86 261 50 2 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7MPY0 7.19e-86 259 52 2 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Vibrio vulnificus (strain YJ016)
Q8DDU4 1.92e-84 255 52 2 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Vibrio vulnificus (strain CMCP6)
Q87TC2 4.34e-83 252 54 2 246 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KNL4 7.01e-83 251 49 2 255 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B6EPQ0 1.11e-82 251 50 2 253 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Aliivibrio salmonicida (strain LFI1238)
C4K407 2.92e-82 250 47 1 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A7MST3 1.11e-81 248 52 2 246 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Vibrio campbellii (strain ATCC BAA-1116)
A4ST17 3.96e-81 247 49 3 251 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Aeromonas salmonicida (strain A449)
A0KF11 4.09e-81 247 50 3 251 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q6LVQ7 6.39e-81 246 49 2 253 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Photobacterium profundum (strain SS9)
B7VHH1 1.14e-80 246 49 2 256 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Vibrio atlanticus (strain LGP32)
Q8E8N6 1.42e-73 228 47 6 251 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HPU6 3.39e-73 227 48 6 245 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Shewanella sp. (strain MR-7)
B1KM44 7.2e-72 223 44 3 256 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Shewanella woodyi (strain ATCC 51908 / MS32)
Q89A54 1.5e-70 220 38 3 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8D1X1 8.61e-69 216 39 2 259 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Wigglesworthia glossinidia brevipalpis
Q5QZC0 1.02e-66 210 43 2 244 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q15N09 4.89e-63 201 42 3 250 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
C4LA13 1.45e-59 192 42 3 257 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q82SL8 4.98e-52 172 38 4 248 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q87DT3 1.1e-44 154 37 8 259 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9H6 1.1e-44 154 37 8 259 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Xylella fastidiosa (strain M23)
Q5NZF6 5.07e-44 152 38 4 249 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B0U6I9 2.85e-43 150 35 7 256 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Xylella fastidiosa (strain M12)
Q2Y9Y7 5.67e-42 147 33 4 259 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q5WW99 1.04e-41 145 33 6 248 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Legionella pneumophila (strain Lens)
Q9PDM3 1.77e-41 145 35 8 259 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Xylella fastidiosa (strain 9a5c)
Q5X590 1.91e-41 145 34 6 248 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Legionella pneumophila (strain Paris)
A5IBW4 4.18e-41 144 33 6 248 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Legionella pneumophila (strain Corby)
Q5ZVG6 4.66e-41 144 33 6 248 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q609V0 1.19e-40 143 34 2 252 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q5H6D1 3.31e-40 142 38 5 242 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P907 3.31e-40 142 38 5 242 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2FLM6 5.11e-40 142 39 7 249 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Stenotrophomonas maltophilia (strain K279a)
Q8PQE0 6.85e-40 141 38 5 242 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Xanthomonas axonopodis pv. citri (strain 306)
B4SM83 1e-39 141 38 7 249 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Stenotrophomonas maltophilia (strain R551-3)
Q8PDF3 2.66e-38 137 38 4 241 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RMQ9 2.66e-38 137 38 4 241 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Xanthomonas campestris pv. campestris (strain B100)
Q4UZP1 2.66e-38 137 38 4 241 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Xanthomonas campestris pv. campestris (strain 8004)
Q7NPW5 9.77e-36 130 34 4 250 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
C5BMZ8 7.48e-35 134 33 2 251 3 bioC Biotin biosynthesis bifunctional protein BioHC Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q5F641 1.1e-29 114 30 4 250 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9JSN0 5.8e-26 106 30 4 250 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A1KRU9 8.16e-26 104 30 4 250 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
E6MWF8 1.36e-25 104 29 4 250 1 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Neisseria meningitidis serogroup B / serotype 15 (strain H44/76)
Q9K197 1.36e-25 104 29 4 250 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B3PI89 1.15e-21 97 28 4 244 3 bioC Biotin biosynthesis bifunctional protein BioHC Cellvibrio japonicus (strain Ueda107)
Q21FY5 1.46e-19 90 28 6 245 3 bioC Biotin biosynthesis bifunctional protein BioHC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A1JMX1 1.22e-14 75 26 7 269 3 rutD Putative carbamate hydrolase RutD Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
O06734 1.3e-14 74 27 11 261 3 yisY AB hydrolase superfamily protein YisY Bacillus subtilis (strain 168)
A8GCT3 1.57e-13 71 28 5 254 3 rutD Putative carbamate hydrolase RutD Serratia proteamaculans (strain 568)
O07015 1.3e-11 66 24 3 247 1 rsbQ Sigma factor SigB regulation protein RsbQ Bacillus subtilis (strain 168)
P0A573 2.51e-11 66 25 9 270 3 BQ2027_MB2734 Uncharacterized protein Mb2734 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WNH3 2.51e-11 66 25 9 270 1 Rv2715 Uncharacterized protein Rv2715 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNH2 2.51e-11 66 25 9 270 3 MT2788 Uncharacterized protein MT2788 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q2T4P1 4.7e-10 63 27 9 269 3 thaQ Polyketide synthase ThaQ Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A4W922 1.54e-09 60 27 8 261 3 rutD Putative carbamate hydrolase RutD Enterobacter sp. (strain 638)
O34592 5.85e-09 58 24 10 265 2 ydjP AB hydrolase superfamily protein YdjP Bacillus subtilis (strain 168)
C9Y0S4 6.07e-09 58 28 5 207 3 rutD Putative carbamate hydrolase RutD Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)
B1ZB18 1.23e-08 57 26 7 258 3 rutD Putative carbamate hydrolase RutD Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
H2KZ86 2.3e-08 57 36 3 102 1 abhd-5.2 Abhydrolase domain-containing protein abhd-5.2 Caenorhabditis elegans
B7KWT4 5.14e-08 55 26 6 256 3 rutD Putative carbamate hydrolase RutD Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q47GC1 1.11e-07 55 22 6 267 3 mhpC2 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase 2 Dechloromonas aromatica (strain RCB)
A8IAD8 1.28e-07 54 24 5 263 3 rutD Putative carbamate hydrolase RutD Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P91143 2.59e-07 54 32 2 102 3 abhd-5.1 Abhydrolase domain-containing protein abhd-5.1 Caenorhabditis elegans
Q9SZU7 5.29e-07 53 24 7 253 1 KAI2 Probable esterase KAI2 Arabidopsis thaliana
A9W3H8 8.52e-07 52 26 7 263 3 rutD Putative carbamate hydrolase RutD Methylorubrum extorquens (strain PA1)
P27747 1.01e-06 52 31 3 119 1 acoC Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
O32234 1.6e-06 51 31 3 112 2 yvaM AB hydrolase superfamily protein YvaM Bacillus subtilis (strain 168)
Q47HL4 1.84e-06 51 22 6 265 3 mhpC1 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase 1 Dechloromonas aromatica (strain RCB)
B0SW62 2.92e-06 50 22 6 257 3 rutD Putative carbamate hydrolase RutD Caulobacter sp. (strain K31)
O05235 3.47e-06 50 22 8 240 3 yugF Uncharacterized hydrolase YugF Bacillus subtilis (strain 168)
Q10J20 4.42e-06 50 24 9 257 1 D14L Probable esterase D14L Oryza sativa subsp. japonica
A6TAC7 4.99e-06 50 22 4 263 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
C5B0U6 7.11e-06 49 26 7 258 3 rutD Putative carbamate hydrolase RutD Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
P24640 1.22e-05 49 20 6 253 1 lip3 Lipase 3 Moraxella sp. (strain TA144)
B2JQW2 1.35e-05 48 24 10 277 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
I6XU97 1.61e-05 48 24 10 267 1 Rv0045c Esterase Rv0045c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q55921 2.09e-05 48 23 9 264 3 slr0314 Putative non-heme chloroperoxidase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B7NLB7 2.11e-05 48 24 7 254 3 rutD Putative carbamate hydrolase RutD Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q02104 2.12e-05 48 22 7 249 1 lip1 Lipase 1 Psychrobacter immobilis
A4VQH7 2.46e-05 48 29 6 184 3 rutD Putative carbamate hydrolase RutD Stutzerimonas stutzeri (strain A1501)
Q476M7 2.59e-05 48 24 8 263 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q59695 3.27e-05 48 32 2 109 3 acoC Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system Pseudomonas putida
Q13QH4 7.06e-05 46 21 4 262 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Paraburkholderia xenovorans (strain LB400)
C7CM33 7.71e-05 46 24 5 256 3 rutD Putative carbamate hydrolase RutD Methylorubrum extorquens (strain DSM 6343 / CIP 106787 / DM4)
Q4ZXS0 8.04e-05 46 24 5 257 3 rutD Putative carbamate hydrolase RutD Pseudomonas syringae pv. syringae (strain B728a)
B6HZX5 8.93e-05 46 23 6 265 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli (strain SE11)
B7N8Q6 8.93e-05 46 23 6 265 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A7ZWZ6 8.93e-05 46 23 6 265 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli O9:H4 (strain HS)
B7M2Z7 8.93e-05 46 23 6 265 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli O8 (strain IAI1)
B7NK06 8.93e-05 46 23 6 265 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7L505 8.93e-05 46 23 6 265 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli (strain 55989 / EAEC)
A7ZI96 8.93e-05 46 23 6 265 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8X5K0 9.01e-05 46 23 6 265 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli O157:H7
B7MPB6 9.97e-05 46 23 6 265 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli O81 (strain ED1a)
P9WNH5 0.000108 46 24 9 276 1 hsaD 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNH4 0.000108 46 24 9 276 3 hsaD 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P77044 0.000132 45 23 6 265 1 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli (strain K12)
B1XBJ6 0.000132 45 23 6 265 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli (strain K12 / DH10B)
O22975 0.000134 46 31 2 108 1 At4g24160 1-acylglycerol-3-phosphate O-acyltransferase Arabidopsis thaliana
Q6F9F4 0.000276 45 27 4 111 1 tgnD (E)-2-((N-methylformamido)methylene)succinate hydrolase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A4WCP8 0.000388 44 23 8 242 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Enterobacter sp. (strain 638)
B7M8Z4 0.0004 44 23 7 254 3 rutD Putative carbamate hydrolase RutD Escherichia coli O8 (strain IAI1)
Q66IG4 0.000473 44 33 4 113 2 ndrg1 Protein NDRG1 Xenopus tropicalis
Q9EPB5 0.000615 43 28 1 103 1 Serhl Serine hydrolase-like protein Mus musculus
A4JPX5 0.000768 43 22 5 270 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Burkholderia vietnamiensis (strain G4 / LMG 22486)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS14425
Feature type CDS
Gene bioH
Product pimeloyl-ACP methyl ester esterase BioH
Location 112391 - 113164 (strand: 1)
Length 774 (nucleotides) / 257 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000004
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1667
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00561 alpha/beta hydrolase fold

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0596 Coenzyme transport and metabolism (H)
General function prediction only (R)
HR 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02170 pimeloyl-[acyl-carrier protein] methyl ester esterase [EC:3.1.1.85] Biotin metabolism
Metabolic pathways
Biosynthesis of cofactors
Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP

Protein Sequence

MATLFWQRSGQGKRNLVLLHGWGLNGEVWSSIETRLAPHFCIHKVDLPGYGRSQEFGEMSLSEMADVVYAQMPENSVLAGWSLGGLVATQIALTHPQAVSHLVTISSSPCFGAREEEGWPGIKPTVLSGFQHQLETDFQRTVERFLALQTLGTASARQDARILKSVVLAQPLPDVAVLNAGLEILRTTDMRPQLISLTMPFLRIYGYLDGLVPRKVAQLLDEQLPLSPSDVMRNSGHAPFISHPDEFCDVLLGFVDR

Flanking regions ( +/- flanking 50bp)

TCAATAATAACCATCCGTCTTCCCTCCGGATAAATAAGGACACAATAGCGATGGCGACTCTTTTTTGGCAGCGAAGCGGGCAGGGCAAACGCAATCTTGTGCTGTTGCACGGCTGGGGACTGAACGGCGAAGTATGGAGCAGTATTGAAACGCGACTAGCGCCGCATTTTTGTATTCATAAGGTTGATTTGCCGGGCTACGGGCGCAGTCAGGAATTTGGTGAGATGTCATTGAGTGAGATGGCGGACGTCGTGTATGCACAGATGCCGGAGAATTCTGTGCTGGCAGGCTGGTCGCTGGGCGGACTGGTGGCAACACAGATTGCGCTGACACACCCGCAGGCAGTGAGTCATCTGGTGACTATCAGCTCCTCTCCCTGTTTTGGTGCGCGGGAAGAAGAAGGCTGGCCCGGGATCAAACCCACGGTTCTGAGCGGGTTTCAGCATCAGCTGGAGACTGATTTTCAGCGCACAGTCGAACGTTTTCTTGCGTTGCAGACACTGGGAACCGCGAGTGCCCGCCAGGATGCGCGGATACTGAAATCCGTGGTACTGGCGCAGCCACTGCCGGATGTAGCTGTACTGAATGCCGGTCTGGAGATTCTGCGGACAACTGACATGCGTCCGCAGCTTATATCACTGACAATGCCGTTCCTGCGTATCTACGGGTATCTGGACGGGTTGGTGCCGCGTAAAGTTGCACAACTGCTGGATGAACAACTGCCGTTATCGCCATCGGACGTTATGCGTAACAGCGGACATGCGCCGTTTATTTCTCATCCGGATGAATTCTGTGATGTGTTGCTGGGGTTTGTGGACAGATAATTCAGAAAAAAGCCGGTTAGTTAAAATAACCAACCGGCCTTTTCAGAATT