Homologs in group_1331

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07565 FBDBKF_07565 95.8 Morganella morganii S1 eutN ethanolamine utilization microcompartment protein EutN
EHELCC_17235 EHELCC_17235 95.8 Morganella morganii S2 eutN ethanolamine utilization microcompartment protein EutN
NLDBIP_13840 NLDBIP_13840 95.8 Morganella morganii S4 eutN ethanolamine utilization microcompartment protein EutN
LHKJJB_09010 LHKJJB_09010 95.8 Morganella morganii S3 eutN ethanolamine utilization microcompartment protein EutN
HKOGLL_08560 HKOGLL_08560 95.8 Morganella morganii S5 eutN ethanolamine utilization microcompartment protein EutN
PMI_RS13395 PMI_RS13395 33.7 Proteus mirabilis HI4320 - EutN/CcmL family microcompartment protein

Distribution of the homologs in the orthogroup group_1331

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1331

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEJ8 3.27e-46 146 75 0 95 1 eutN Bacterial microcompartment shell vertex protein EutN Escherichia coli (strain K12)
P0AEJ9 3.27e-46 146 75 0 95 3 eutN Bacterial microcompartment shell vertex protein EutN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P41792 4.55e-46 145 74 0 95 1 eutN Bacterial microcompartment shell vertex protein EutN Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P72759 1.5e-18 76 40 0 95 1 ccmL Carboxysome shell vertex protein CcmL Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8YYI2 8.73e-18 74 41 1 96 1 ccmL Carboxysome shell vertex protein CcmL Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q03512 1.16e-17 73 38 0 95 1 ccmL Carboxysome shell vertex protein CcmL Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q7NIT8 8.21e-17 72 36 0 95 1 ccmL Carboxysome shell vertex protein CcmL Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
D0LHE5 2.56e-16 70 42 0 95 1 Hoch_5814 Bacterial microcompartment shell vertex protein Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2)
P0DUM1 1.52e-15 68 42 0 83 1 grpN Bacterial microcompartment shell vertex protein GrpN Rhodospirillum rubrum (strain F11)
P0DUV6 1.45e-13 63 47 2 87 1 pduN Bacterial microcompartment shell vertex protein PduN Citrobacter freundii
Q8DKB4 9.73e-13 61 31 0 95 1 ccmL Carboxysome shell vertex protein CcmL Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q9XDN3 1.49e-12 60 43 1 87 1 pduN Bacterial microcompartment shell vertex protein PduN Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q7V2C6 5.14e-10 54 36 2 84 1 csoS4A Carboxysome shell vertex protein CsoS4A Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
O85043 8.85e-10 53 40 2 84 1 csoS4A Carboxysome shell vertex protein CsoS4A Halothiobacillus neapolitanus (strain ATCC 23641 / c2)
Q7V2C5 7.79e-09 50 41 1 74 3 csoS4B Carboxysome shell vertex protein CsoS4B Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q31HD5 3.42e-08 49 35 1 84 1 csoS4A Carboxysome shell vertex protein CsoS4A Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
O85044 3.33e-07 47 36 1 86 1 csoS4B Carboxysome shell vertex protein CsoS4B Halothiobacillus neapolitanus (strain ATCC 23641 / c2)
Q31HD4 2.01e-06 45 32 1 84 3 csoS4B Carboxysome shell vertex protein CsoS4B Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS13555
Feature type CDS
Gene eutN
Product ethanolamine utilization microcompartment protein EutN
Location 346294 - 346581 (strand: -1)
Length 288 (nucleotides) / 95 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000003
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1331
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03319 Ethanolamine utilisation protein EutN/carboxysome

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4576 Secondary metabolites biosynthesis, transport and catabolism (Q)
Energy production and conversion (C)
QC Carboxysome shell and ethanolamine utilization microcompartment protein CcmK/EutM

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04028 ethanolamine utilization protein EutN - -

Protein Sequence

MKLAVVIGQIVCTVRHPGLDHDKLLLVEMIDRQGNPNGEVAVATDSIGAGNGEWVLIVSGSSARRAQNKEASPVDLSIIGIVDEAVMESQVIFHK

Flanking regions ( +/- flanking 50bp)

AAATCCGTAGCCGGCTGTATTCAGGCTGCTGAAATAGAAAGGAGGTGAACATGAAACTCGCTGTTGTTATCGGACAGATCGTGTGCACCGTGCGTCATCCCGGATTGGATCACGACAAATTACTGCTGGTGGAAATGATTGACCGCCAGGGGAATCCAAACGGTGAGGTGGCCGTCGCAACCGACAGTATCGGTGCGGGTAATGGTGAATGGGTGCTGATCGTCAGCGGAAGCTCGGCGCGGCGTGCTCAGAACAAAGAAGCATCACCGGTTGATCTCAGCATCATCGGCATTGTGGACGAGGCCGTTATGGAAAGTCAGGTGATTTTTCATAAATAAATCGCTGCAACGAGTCACAGAAAGAGGCGTGGGTGAATATGGATCAGAAA