Homologs in group_2938

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13935 FBDBKF_13935 72.6 Morganella morganii S1 ykgJ YkgJ family cysteine cluster protein
EHELCC_11605 EHELCC_11605 72.6 Morganella morganii S2 ykgJ YkgJ family cysteine cluster protein
NLDBIP_11950 NLDBIP_11950 72.6 Morganella morganii S4 ykgJ YkgJ family cysteine cluster protein
LHKJJB_11810 LHKJJB_11810 72.6 Morganella morganii S3 ykgJ YkgJ family cysteine cluster protein
HKOGLL_10420 HKOGLL_10420 72.6 Morganella morganii S5 ykgJ YkgJ family cysteine cluster protein

Distribution of the homologs in the orthogroup group_2938

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2938

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFT8 1.16e-30 106 63 0 84 1 yeiW UPF0153 protein YeiW Escherichia coli (strain K12)
P0AFT9 1.16e-30 106 63 0 84 3 yeiW UPF0153 protein YeiW Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9KT48 8.28e-24 88 53 0 82 3 VC_1057 UPF0153 protein VC_1057 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P58040 2.95e-23 87 51 0 82 3 PA1578.1 UPF0153 protein PA1578.1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS12790
Feature type CDS
Gene -
Product zinc/iron-chelating domain-containing protein
Location 159094 - 159348 (strand: -1)
Length 255 (nucleotides) / 84 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000003
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2938
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF03692 Putative zinc- or iron-chelating domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06940 uncharacterized protein - -

Protein Sequence

MECRSGCGACCIAPSISSPIPGMLGGKPANTRCVQLSVNNACLIFGLALRPQVCISLNPAQEMCLSSRAEAMTYLLDLEKDTLP

Flanking regions ( +/- flanking 50bp)

GCAGGGTAATTCAACGTAATTCGGGTCGTTAATAGCAAAAGGCGGAATATATGGAATGTCGCAGTGGTTGCGGGGCTTGTTGTATTGCGCCTTCAATTTCGTCACCCATTCCGGGTATGCTGGGCGGAAAGCCCGCCAATACCCGATGTGTGCAGTTATCCGTCAATAACGCATGTCTTATCTTTGGTCTGGCGTTACGCCCGCAGGTTTGTATCAGTCTCAATCCGGCACAGGAAATGTGTTTATCGAGCCGTGCAGAGGCAATGACGTATTTGCTGGATCTCGAAAAAGACACATTACCGTAAACGCTGACAGTGTTTTTTTGTTGTATCTGCACAAAATTACATGTTCAGGC