Homologs in group_327

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09885 FBDBKF_09885 27.2 Morganella morganii S1 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase MenH and related esterases, alpha/beta hydrolase fold
EHELCC_04685 EHELCC_04685 27.2 Morganella morganii S2 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase MenH and related esterases, alpha/beta hydrolase fold
NLDBIP_04685 NLDBIP_04685 27.2 Morganella morganii S4 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase MenH and related esterases, alpha/beta hydrolase fold
LHKJJB_13945 LHKJJB_13945 27.2 Morganella morganii S3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase MenH and related esterases, alpha/beta hydrolase fold
HKOGLL_12590 HKOGLL_12590 27.2 Morganella morganii S5 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase MenH and related esterases, alpha/beta hydrolase fold
F4V73_RS00465 F4V73_RS00465 28.4 Morganella psychrotolerans - alpha/beta fold hydrolase
PMI_RS02690 PMI_RS02690 27.4 Proteus mirabilis HI4320 ybfF esterase

Distribution of the homologs in the orthogroup group_327

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_327

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q54528 1.38e-31 122 32 10 304 1 rdmC Aclacinomycin methylesterase RdmC Streptomyces purpurascens
Q54809 8.4e-26 107 29 9 305 3 dnrP Rhodomycin D methylesterase DnrP Streptomyces peucetius
Q55217 5.79e-25 104 29 7 304 1 dauP Rhodomycin D methylesterase DauP Streptomyces sp. (strain C5)
D4GEU7 3.04e-14 74 29 8 240 3 rutD Putative carbamate hydrolase RutD Pantoea ananatis (strain LMG 20103)
A8GCT3 3.25e-14 74 31 7 209 3 rutD Putative carbamate hydrolase RutD Serratia proteamaculans (strain 568)
A1JMX1 1.03e-13 73 31 10 263 3 rutD Putative carbamate hydrolase RutD Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C5CN82 1.3e-11 67 29 10 266 3 rutD Putative carbamate hydrolase RutD Variovorax paradoxus (strain S110)
Q13QH4 2.86e-11 66 30 3 176 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Paraburkholderia xenovorans (strain LB400)
B2JQW2 2.98e-11 66 27 7 257 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
P00632 9.79e-11 64 26 8 269 1 catD 3-oxoadipate enol-lactonase 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q47GC1 2.06e-10 63 25 8 262 3 mhpC2 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase 2 Dechloromonas aromatica (strain RCB)
Q476M7 2.36e-10 63 25 9 273 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q47HL4 4.44e-10 62 26 6 236 3 mhpC1 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase 1 Dechloromonas aromatica (strain RCB)
A4JPX5 7.9e-10 62 26 7 257 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Burkholderia vietnamiensis (strain G4 / LMG 22486)
D5VGV3 1.73e-09 60 26 11 277 3 rutD Putative carbamate hydrolase RutD Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059)
B0SW62 2.91e-09 60 25 8 256 3 rutD Putative carbamate hydrolase RutD Caulobacter sp. (strain K31)
O07015 4.69e-09 59 28 6 188 1 rsbQ Sigma factor SigB regulation protein RsbQ Bacillus subtilis (strain 168)
A6TAC7 5.09e-09 59 24 8 271 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q59093 8.84e-09 58 27 8 260 4 pcaD 3-oxoadipate enol-lactonase 1 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
O07732 9.01e-09 59 27 8 228 1 lipJ Bifunctional lipase/adenylate cyclase LipJ Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q48MQ7 1.37e-08 58 27 6 196 3 rutD Putative carbamate hydrolase RutD Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q52011 1.44e-08 58 32 10 195 2 bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Pseudomonas furukawaii
P77044 1.59e-08 58 25 6 233 1 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli (strain K12)
B1XBJ6 1.59e-08 58 25 6 233 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli (strain K12 / DH10B)
B7MPB6 2.53e-08 57 25 6 233 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli O81 (strain ED1a)
Q4ZXS0 2.89e-08 57 26 8 259 3 rutD Putative carbamate hydrolase RutD Pseudomonas syringae pv. syringae (strain B728a)
Q8X5K0 3.13e-08 57 25 6 233 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli O157:H7
B6HZX5 3.22e-08 57 25 6 233 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli (strain SE11)
B7N8Q6 3.22e-08 57 25 6 233 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A7ZWZ6 3.22e-08 57 25 6 233 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli O9:H4 (strain HS)
B7M2Z7 3.22e-08 57 25 6 233 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli O8 (strain IAI1)
B7NK06 3.22e-08 57 25 6 233 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7L505 3.22e-08 57 25 6 233 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli (strain 55989 / EAEC)
A7ZI96 3.22e-08 57 25 6 233 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Escherichia coli O139:H28 (strain E24377A / ETEC)
A8IAD8 4e-08 57 29 8 262 3 rutD Putative carbamate hydrolase RutD Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B8H1Q3 5.66e-08 56 28 6 191 3 rutD Putative carbamate hydrolase RutD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A4N3 5.66e-08 56 28 6 191 3 rutD Putative carbamate hydrolase RutD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q52532 7.33e-08 56 26 3 175 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Pseudomonas sp.
Q400K3 8.03e-08 56 25 9 273 3 mhpC2 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase 2 Pseudomonas putida
P22862 8.15e-08 55 29 10 243 1 estF Arylesterase Pseudomonas fluorescens
Q59324 1.36e-07 55 30 7 192 3 bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Comamonas testosteroni
A4VQH7 1.38e-07 55 26 9 263 3 rutD Putative carbamate hydrolase RutD Stutzerimonas stutzeri (strain A1501)
P26495 2.75e-07 54 27 5 187 3 phaZ Poly(3-hydroxyalkanoate) depolymerase Pseudomonas oleovorans
Q52036 2.82e-07 54 27 5 183 3 bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Pseudomonas putida
Q49KF8 4.93e-07 53 24 7 236 3 mhpC1 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase 1 Pseudomonas putida
P9WNH1 6.58e-07 53 27 11 279 1 bpoC Putative non-heme bromoperoxidase BpoC Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNH0 6.58e-07 53 27 11 279 3 bpoC Putative non-heme bromoperoxidase BpoC Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
I6YC03 8.3e-07 53 28 3 148 1 ephB Epoxide hydrolase B Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P95276 8.3e-07 53 28 3 148 1 MT1988 Epoxide hydrolase B Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8KZP5 8.61e-07 53 26 4 182 1 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Comamonas testosteroni
A1VUV0 1.76e-06 52 26 4 182 3 bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Polaromonas naphthalenivorans (strain CJ2)
P47229 2.14e-06 52 27 5 183 1 bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Paraburkholderia xenovorans (strain LB400)
B1ZB18 2.2e-06 51 29 10 265 3 rutD Putative carbamate hydrolase RutD Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A4W922 5.26e-06 50 25 11 275 3 rutD Putative carbamate hydrolase RutD Enterobacter sp. (strain 638)
Q2VLB9 5.81e-06 50 27 4 179 3 bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Burkholderia cepacia
A0KF11 6.08e-06 50 28 3 169 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C5BGT3 1.05e-05 49 29 4 167 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Edwardsiella ictaluri (strain 93-146)
Q59695 1.28e-05 49 25 10 280 3 acoC Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system Pseudomonas putida
Q0TJ58 1.3e-05 49 23 8 280 3 rutD Putative carbamate hydrolase RutD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P17548 1.62e-05 49 30 5 162 1 bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Pseudomonas sp. (strain KKS102)
B1LIZ6 1.78e-05 48 23 8 280 3 rutD Putative carbamate hydrolase RutD Escherichia coli (strain SMS-3-5 / SECEC)
P0DO69 2.33e-05 48 30 5 138 1 EPH2 Epoxide hydrolase 2 Siraitia grosvenorii
B1M5I5 2.41e-05 48 27 10 269 3 rutD Putative carbamate hydrolase RutD Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q7CWX3 2.64e-05 48 26 7 234 3 rutD Putative carbamate hydrolase RutD Agrobacterium fabrum (strain C58 / ATCC 33970)
B7NLB7 2.69e-05 48 27 11 265 3 rutD Putative carbamate hydrolase RutD Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B9JLT6 3.05e-05 48 25 6 231 3 rutD Putative carbamate hydrolase RutD Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q1RDK8 3.38e-05 48 27 11 265 3 rutD Putative carbamate hydrolase RutD Escherichia coli (strain UTI89 / UPEC)
P29715 3.39e-05 48 25 8 267 1 bpoA2 Non-haem bromoperoxidase BPO-A2 Kitasatospora aureofaciens
Q5QZC0 3.4e-05 48 27 5 172 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
D5CZG9 3.51e-05 48 27 11 265 3 rutD Putative carbamate hydrolase RutD Escherichia coli O18:K1:H7 (strain IHE3034 / ExPEC)
A1A9R4 3.51e-05 48 27 11 265 3 rutD Putative carbamate hydrolase RutD Escherichia coli O1:K1 / APEC
B7MIF6 3.51e-05 48 27 11 265 3 rutD Putative carbamate hydrolase RutD Escherichia coli O45:K1 (strain S88 / ExPEC)
Q9RVZ8 4e-05 48 27 14 308 3 metXA Homoserine O-acetyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A7ZKB4 4.14e-05 47 25 10 262 3 rutD Putative carbamate hydrolase RutD Escherichia coli O139:H28 (strain E24377A / ETEC)
B5XTS4 4.83e-05 47 29 3 169 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Klebsiella pneumoniae (strain 342)
D2NGI6 5.16e-05 47 26 11 265 3 rutD Putative carbamate hydrolase RutD Escherichia coli O150:H5 (strain SE15)
Q8FJ43 5.28e-05 47 26 10 265 3 rutD Putative carbamate hydrolase RutD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q83WC8 5.71e-05 47 22 10 282 1 dch Bifunctional esterase/perhydrolase DCH Acinetobacter calcoaceticus
B7UNZ2 6.19e-05 47 26 10 265 3 rutD Putative carbamate hydrolase RutD Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A1JSF8 7.07e-05 47 27 3 169 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q83LK8 7.57e-05 47 26 10 264 3 rutD Putative carbamate hydrolase RutD Shigella flexneri
D2AC40 7.57e-05 47 26 10 264 3 rutD Putative carbamate hydrolase RutD Shigella flexneri serotype X (strain 2002017)
B7KWT4 7.69e-05 47 28 8 235 3 rutD Putative carbamate hydrolase RutD Methylorubrum extorquens (strain CM4 / NCIMB 13688)
P0DO70 7.99e-05 47 41 1 63 1 EPH3 Epoxide hydrolase 3 Siraitia grosvenorii
O31168 9.09e-05 47 24 8 267 1 cpo Non-heme chloroperoxidase Kitasatospora aureofaciens
Q5SK89 0.000102 47 28 6 213 3 metXA Homoserine O-acetyltransferase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P0A573 0.000104 47 24 11 273 3 BQ2027_MB2734 Uncharacterized protein Mb2734 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WNH3 0.000104 47 24 11 273 1 Rv2715 Uncharacterized protein Rv2715 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNH2 0.000104 47 24 11 273 3 MT2788 Uncharacterized protein MT2788 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9RA51 0.000109 47 27 7 222 1 metXA Homoserine O-acetyltransferase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
P19076 0.00015 46 28 7 205 3 dmpD 2-hydroxymuconate semialdehyde hydrolase Pseudomonas sp. (strain CF600)
Q0T625 0.000152 46 26 10 264 3 rutD Putative carbamate hydrolase RutD Shigella flexneri serotype 5b (strain 8401)
P25026 0.000153 46 25 11 259 1 cpo Non-heme chloroperoxidase Burkholderia pyrrocinia
D5CE35 0.000227 45 24 9 267 3 rutD Putative carbamate hydrolase RutD Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCTC 10005 / WDCM 00083 / NCDC 279-56)
P27747 0.000254 45 33 3 121 1 acoC Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P34913 0.000284 45 32 4 112 1 EPHX2 Bifunctional epoxide hydrolase 2 Homo sapiens
Q6CZL9 0.000307 45 30 5 165 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5FUF4 0.000332 45 30 4 141 3 metXA Homoserine O-acetyltransferase Gluconobacter oxydans (strain 621H)
C7CM33 0.000417 44 36 4 98 3 rutD Putative carbamate hydrolase RutD Methylorubrum extorquens (strain DSM 6343 / CIP 106787 / DM4)
Q1JU72 0.000492 44 31 4 136 1 fac-dex Fluoroacetate dehalogenase Burkholderia sp.
P23133 0.000778 43 25 8 215 1 todF 2-hydroxy-6-oxo-2,4-heptadienoate hydrolase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q6IE26 0.000838 44 27 8 202 2 Ephx4 Epoxide hydrolase 4 Mus musculus
C6DGH6 0.000861 43 30 5 163 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q1J115 0.001 43 26 14 303 1 metXA Homoserine O-acetyltransferase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS12505
Feature type CDS
Gene -
Product alpha/beta hydrolase
Location 92719 - 93621 (strand: -1)
Length 903 (nucleotides) / 300 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_327
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00561 alpha/beta hydrolase fold

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0596 Coenzyme transport and metabolism (H)
General function prediction only (R)		 HR 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold

Protein Sequence

MTIHKVNDIELCCDSFGDNNATAILLIAGLGTQMIRWPVLFCEMLAARGYRVIRFDNRDTGCSSHFTGCPAPDFAALAAAFAAGQQPDVPYTLYDMAGDVVGLLDALGIERAHLVGRSMGGMIAQIAAGQYPERVMSLTSIMSGTGNPALPSASPEVMAMLTQRVPNPQEDEAGFLAHSLAFARLIASPGYPFDEDAHRALIQEEISRSCDSTGFGRQIAAIAATGDLRPLLAGITVPSLVVHGADDLLVPAACGKDTASSISGSEFMLIDGMGHDLPSQLYQRVTDGIDRVARGFPYSG

Flanking regions ( +/- flanking 50bp)

GACGCAATGAACCCTATGATCAGTAATTATGAATCGGGCCGGAACAGAAAATGACTATTCACAAAGTCAATGACATAGAGTTGTGCTGCGACAGTTTCGGCGATAACAATGCCACAGCCATTCTTTTAATCGCCGGTCTCGGAACACAAATGATCCGCTGGCCGGTCTTGTTTTGCGAAATGCTGGCAGCAAGAGGTTATCGGGTGATCCGCTTCGACAATCGTGATACCGGTTGCTCATCACATTTTACGGGCTGTCCCGCACCGGATTTCGCCGCACTGGCTGCTGCTTTTGCTGCCGGACAACAGCCTGATGTGCCTTATACATTGTACGACATGGCGGGCGACGTGGTTGGCTTGCTTGATGCGCTGGGTATAGAACGAGCTCATCTTGTCGGCAGATCCATGGGCGGCATGATTGCTCAGATAGCAGCAGGTCAATATCCGGAGCGGGTAATGTCGCTGACATCGATTATGTCCGGTACGGGAAATCCGGCTCTTCCTTCCGCTTCGCCGGAGGTTATGGCGATGCTGACACAGCGTGTGCCAAATCCTCAGGAGGATGAAGCCGGATTTCTGGCGCACAGCCTCGCTTTCGCCAGGCTGATAGCCAGCCCCGGTTATCCGTTTGACGAGGACGCCCACCGGGCGCTCATTCAGGAGGAGATCAGCCGGTCCTGTGACTCAACCGGTTTCGGGCGACAGATTGCCGCGATCGCCGCCACAGGTGATCTTCGTCCGCTGTTGGCCGGGATCACTGTGCCTTCATTGGTTGTGCATGGAGCGGACGATCTTCTGGTTCCTGCTGCCTGCGGCAAAGATACTGCCTCTTCAATAAGTGGATCGGAGTTCATGCTTATTGACGGAATGGGTCACGACCTGCCATCTCAACTTTATCAGAGAGTGACAGACGGGATTGACAGGGTTGCGCGAGGCTTCCCGTACTCCGGATAATATCAACCGGGCGATACCCGGTGATCAGCTACTGCTTCCGGCAAGGACTT