Homologs in group_725

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03195 FBDBKF_03195 72.9 Morganella morganii S1 mlaB lipid asymmetry maintenance protein MlaB
EHELCC_07340 EHELCC_07340 72.9 Morganella morganii S2 mlaB lipid asymmetry maintenance protein MlaB
NLDBIP_07665 NLDBIP_07665 72.9 Morganella morganii S4 mlaB lipid asymmetry maintenance protein MlaB
LHKJJB_07200 LHKJJB_07200 72.9 Morganella morganii S3 mlaB lipid asymmetry maintenance protein MlaB
HKOGLL_03730 HKOGLL_03730 72.9 Morganella morganii S5 mlaB lipid asymmetry maintenance protein MlaB
PMI_RS18205 PMI_RS18205 40.0 Proteus mirabilis HI4320 mlaB lipid asymmetry maintenance protein MlaB

Distribution of the homologs in the orthogroup group_725

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_725

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64603 6.17e-09 52 33 2 95 3 mlaB Intermembrane phospholipid transport system binding protein MlaB Shigella flexneri
P64602 6.17e-09 52 33 2 95 1 mlaB Intermembrane phospholipid transport system binding protein MlaB Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11725
Feature type CDS
Gene mlaB
Product lipid asymmetry maintenance protein MlaB
Location 494090 - 494380 (strand: 1)
Length 291 (nucleotides) / 96 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_725
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13466 STAS domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3113 Cell wall/membrane/envelope biogenesis (M) M Binding protein subunit MlaB of the ABC-type intermembrane phospholipid transporter Mla, contains STAS domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07122 phospholipid transport system transporter-binding protein ABC transporters -

Protein Sequence

MTAALTWEKHNDVLALTGELDRDTLMSFWTARQAQMDCVRTVDVSGLAHVDSAGLAMLVRLKSEQGDTPLVLAGVSPNLQMLISLYGVASEFSDNQ

Flanking regions ( +/- flanking 50bp)

ACTGAGCTGGAGCGCAGTGCAAAAACACCTATCACGCTGGATCAGAAATAATGACTGCCGCACTGACGTGGGAAAAACACAATGACGTGCTTGCACTGACAGGTGAACTGGATCGCGACACACTGATGTCGTTCTGGACAGCGCGTCAGGCGCAGATGGATTGCGTGCGGACAGTGGATGTATCCGGTCTGGCGCATGTGGACTCAGCGGGACTTGCCATGCTGGTGCGCCTGAAAAGTGAGCAGGGTGATACCCCGCTGGTGCTGGCAGGGGTGAGCCCGAATCTGCAGATGCTTATTTCACTTTACGGCGTTGCATCTGAATTCAGCGATAATCAGTAATAACGCATGAAACTTAAAATACGGTAAATAACGGCGCGATCGATATAAAT