Homologs in group_3647

Help

4 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS09480 F4V73_RS09480 47.9 Morganella psychrotolerans - hypothetical protein
F4V73_RS09490 F4V73_RS09490 40.3 Morganella psychrotolerans - hypothetical protein
F4V73_RS13440 F4V73_RS13440 40.6 Morganella psychrotolerans - hypothetical protein
F4V73_RS13445 F4V73_RS13445 35.3 Morganella psychrotolerans - hypothetical protein

Distribution of the homologs in the orthogroup group_3647

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3647

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11245
Feature type CDS
Gene -
Product hypothetical protein
Location 389634 - 389852 (strand: 1)
Length 219 (nucleotides) / 72 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3647
Orthogroup size 5
N. genomes 1

Actions

Genomic region

Protein Sequence

MKELNIVEVNAVSGAGRLQDAMTSFGGRIGTKFGGEKGAALVAGLGNKLGGRVETALKGIPVVGKLIGKLLG

Flanking regions ( +/- flanking 50bp)

ATACGGATATATCACATTATATTGCCCGGGAAGGGCGTAAAGGATTAAAAATGAAAGAATTAAACATCGTTGAAGTTAATGCAGTTTCTGGTGCCGGCCGTCTTCAGGACGCTATGACTTCATTTGGTGGCCGTATCGGTACTAAATTTGGCGGGGAAAAAGGCGCAGCACTGGTTGCTGGTCTGGGTAACAAACTGGGCGGCCGTGTTGAAACTGCTCTGAAAGGTATCCCTGTTGTTGGTAAACTGATCGGTAAATTATTAGGTTAATTACCGCTTTTTTTATGAACAAAGCAATAACAAAAGTTAGTCTTATATTT