Homologs in group_1445

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09190 FBDBKF_09190 73.4 Morganella morganii S1 tar Methyl-accepting chemotaxis protein (MCP)
EHELCC_10220 EHELCC_10220 73.4 Morganella morganii S2 tar Methyl-accepting chemotaxis protein (MCP)
NLDBIP_10565 NLDBIP_10565 73.4 Morganella morganii S4 tar Methyl-accepting chemotaxis protein (MCP)
LHKJJB_10790 LHKJJB_10790 73.4 Morganella morganii S3 tar Methyl-accepting chemotaxis protein (MCP)
HKOGLL_13850 HKOGLL_13850 73.4 Morganella morganii S5 tar Methyl-accepting chemotaxis protein (MCP)
PMI_RS13160 PMI_RS13160 39.0 Proteus mirabilis HI4320 - methyl-accepting chemotaxis protein

Distribution of the homologs in the orthogroup group_1445

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1445

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9WYR0 3.61e-11 68 28 1 135 1 mcp1 Methyl-accepting chemotaxis protein 1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9I3S1 7.64e-09 60 28 1 127 1 bdlA Biofilm dispersion protein BdlA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P15492 1.16e-08 60 28 0 109 3 hlyB Methyl-accepting chemotaxis protein HlyB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9X1E2 2.01e-08 59 26 0 138 1 mcp4 Methyl-accepting chemotaxis protein 4 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9I6V2 2.8e-08 58 28 2 109 1 mcpA Methyl-accepting chemotaxis protein McpA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9X0N0 2.94e-08 58 31 3 117 1 mcp3 Methyl-accepting chemotaxis protein 3 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9HUB1 3.89e-08 58 32 0 109 1 mcpK Methyl-accepting chemotaxis protein McpK Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P50466 6.09e-08 57 25 8 200 1 aer Aerotaxis receptor Escherichia coli (strain K12)
Q9HQ00 7.48e-08 57 39 0 68 3 htr9 Halobacterial transducer protein 9 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
P39209 7.95e-08 57 33 1 96 3 tlpC Methyl-accepting chemotaxis protein TlpC Bacillus subtilis (strain 168)
Q9I6V6 1.29e-07 57 30 1 101 1 mcpB Methyl-accepting chemotaxis protein McpB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9Z429 1.41e-07 56 32 3 127 3 nahY Methyl-accepting chemotaxis protein NahY Pseudomonas putida
B0R9Z1 1.58e-07 56 31 1 94 1 car Transducer protein Car Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q88D09 1.94e-07 56 29 0 116 1 mcpQ Methyl-accepting chemotaxis protein McpQ Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q52877 3.4e-07 55 26 3 160 3 mcpE Probable chemoreceptor McpE Rhizobium meliloti (strain 1021)
A5F389 3.41e-07 55 27 5 169 3 tcpI Toxin coregulated pilus biosynthesis protein I Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P0C6D8 3.44e-07 55 27 5 169 3 tcpI Toxin coregulated pilus biosynthesis protein I Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q88JK6 3.91e-07 55 27 1 131 1 pcaY Methyl-accepting chemotaxis protein PcaY Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W2C8 4.31e-07 55 27 1 131 2 pcaY Methyl-accepting chemotaxis protein PcaY Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q9X0M7 4.83e-07 55 24 3 175 1 mcp2 Methyl-accepting chemotaxis protein 2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q55445 5.24e-07 55 24 0 142 3 sll0041 Putative methyl-accepting chemotaxis protein sll0041 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q88E10 5.72e-07 55 28 0 111 1 mcpS Methyl-accepting chemotaxis protein McpS Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
C0SP89 5.79e-07 55 26 4 191 2 yoaH Putative methyl-accepting chemotaxis protein YoaH Bacillus subtilis (strain 168)
P35841 6.09e-07 55 28 3 139 3 dcrA Chemoreceptor protein A Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q9I055 8.76e-07 54 32 4 131 1 mcpN Methyl-accepting chemotaxis protein McpN Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P39214 9.03e-07 54 43 1 67 1 mcpA Methyl-accepting chemotaxis protein McpA Bacillus subtilis (strain 168)
Q02929 1.01e-06 54 24 5 199 3 Cthe_0039 Putative sensory transducer protein Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q9I3F6 1.51e-06 53 28 2 126 1 aer Methyl-accepting chemotaxis protein Aer Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q88KP1 1.89e-06 53 29 6 175 1 mcpA Methyl-accepting chemotaxis protein McpA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9HPR6 2.28e-06 52 30 2 95 3 hemAT Heme-based aerotactic transducer HemAT Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q6HP15 2.31e-06 53 28 5 145 3 BT9727_0355 Probable methyl-accepting chemotaxis protein BT9727_0355 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q9HW91 2.94e-06 52 26 2 197 1 pctB Methyl-accepting chemotaxis protein PctB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9R9U8 3.06e-06 52 44 0 50 3 alkN Putative methyl-accepting chemotaxis AlkN Pseudomonas oleovorans
B0R367 3.72e-06 52 28 0 104 1 mpcT Transducer protein MpcT Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q9HP81 3.75e-06 52 22 1 190 3 htr2 Sensory rhodopsin II transducer Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R6B1 3.75e-06 52 22 1 190 1 htr2 Sensory rhodopsin II transducer Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q9HW93 4.12e-06 52 27 2 194 1 pctC Methyl-accepting chemotaxis protein PctC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P39216 4.7e-06 52 37 2 93 3 tlpA Methyl-accepting chemotaxis protein TlpA Bacillus subtilis (strain 168)
G3XDA3 6.11e-06 51 39 1 66 1 ctpH Methyl-accepting chemotaxis protein CtpH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5V5V4 6.97e-06 51 31 2 116 2 htr2 Sensory rhodopsin II transducer Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q88IY8 7.81e-06 51 25 2 151 1 mcpP Methyl-accepting chemotaxis protein McpP Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88R14 7.82e-06 51 27 2 122 1 mcpH Methyl-accepting chemotaxis protein McpH Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
O07621 8.92e-06 50 28 1 103 1 hemAT Heme-based aerotactic transducer HemAT Bacillus subtilis (strain 168)
P42258 9.86e-06 50 31 2 116 3 htrII Sensory rhodopsin II transducer (Fragment) Haloarcula vallismortis
Q88NI1 1.01e-05 51 29 0 95 1 mcpU Methyl-accepting chemotaxis protein McpU Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P0DMI3 1.03e-05 50 30 1 99 1 htr1 Sensory rhodopsin I transducer Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R632 1.03e-05 50 30 1 99 1 htr1 Sensory rhodopsin I transducer Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
G3XD24 1.1e-05 50 26 2 178 1 pctA Methyl-accepting chemotaxis protein PctA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B0R6I4 1.21e-05 50 31 0 90 1 basT Transducer protein BasT Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q9I0I4 1.25e-05 50 32 0 71 1 tlpQ Methyl-accepting chemotaxis protein TlpQ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q88N45 1.3e-05 50 34 0 96 1 mcpG Methyl-accepting chemotaxis protein McpG Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0R5T0 1.3e-05 50 32 0 79 1 htr8 Transducer protein Htr8 Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q9HUW6 1.47e-05 50 25 3 144 1 ctpL Methyl-accepting chemotaxis protein CtpL Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O32239 1.64e-05 50 34 1 83 3 yvaQ Putative sensory transducer protein YvaQ Bacillus subtilis (strain 168)
Q6HNQ4 2.07e-05 50 29 1 98 3 BT9727_0469 Probable methyl-accepting chemotaxis protein BT9727_0469 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q882Z2 2.17e-05 50 28 3 150 3 pscA Methyl-accepting chemotaxis protein PscA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9HP84 2.19e-05 50 25 2 152 3 cosT Transducer protein CosT Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R6A7 2.19e-05 50 25 2 152 1 cosT Transducer protein CosT Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
B0R474 2.42e-05 50 30 0 95 1 htr18 Transducer protein Htr18 Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q5UXM8 2.65e-05 49 29 1 100 1 htr1 Sensory rhodopsin I transducer Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P42259 2.88e-05 49 27 1 100 1 htr2 Sensory rhodopsin II transducer Natronomonas pharaonis
P39217 2.98e-05 49 38 1 67 3 tlpB Methyl-accepting chemotaxis protein TlpB Bacillus subtilis (strain 168)
Q00986 3.3e-05 49 43 0 48 3 mcpA Chemoreceptor McpA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B0R4N9 3.77e-05 48 37 0 67 1 htr13 Transducer protein Htr13 Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P39215 4.75e-05 48 32 2 83 1 mcpB Methyl-accepting chemotaxis protein McpB Bacillus subtilis (strain 168)
P54576 4.9e-05 48 40 2 64 1 mcpC Methyl-accepting chemotaxis protein McpC Bacillus subtilis (strain 168)
P07018 5.29e-05 48 24 1 106 1 tap Methyl-accepting chemotaxis protein IV Escherichia coli (strain K12)
P07017 5.33e-05 48 27 1 102 1 tar Methyl-accepting chemotaxis protein II Escherichia coli (strain K12)
P0DMI4 6.21e-05 48 24 2 155 3 htr4 Transducer protein Htr4 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R470 6.21e-05 48 24 2 155 1 htr4 Transducer protein Htr4 Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
O06477 0.000134 47 40 0 60 2 yfmS Putative sensory transducer protein YfmS Bacillus subtilis (strain 168)
Q2W4T8 0.000157 47 37 1 72 1 amb2333 Methyl-accepting chemotaxis protein Amb2333 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P42257 0.000167 47 30 1 98 1 pilJ Protein PilJ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P21823 0.00018 47 25 1 101 3 tas Methyl-accepting chemotaxis aspartate transducer Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / CCUG 1429 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006 / CDC 819-56)
P43500 0.000184 47 33 0 59 1 frzCD Frizzy aggregation protein FrzCD Myxococcus xanthus
P55652 0.000184 47 41 0 48 3 NGR_a01640 Probable chemoreceptor y4sI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9I0I6 0.00019 47 37 0 58 1 ctpM Methyl-accepting chemotaxis protein CtpM Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02755 0.000223 46 28 3 118 3 tcp Methyl-accepting chemotaxis citrate transducer Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P21822 0.000224 46 27 2 101 3 tse Methyl-accepting chemotaxis serine transducer Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / CCUG 1429 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006 / CDC 819-56)
P02942 0.000235 46 33 1 74 1 tsr Methyl-accepting chemotaxis protein I Escherichia coli (strain K12)
Q0VTI9 0.000253 46 30 1 98 3 ABO_0106 Putative methyl-accepting chemotaxis AlkN Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q2W8M7 0.000418 45 37 0 67 1 amb0994 Methyl-accepting chemotaxis protein Amb0994 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B0R461 0.000454 45 29 1 101 1 htr6 Transducer protein Htr6 Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS10780
Feature type CDS
Gene -
Product methyl-accepting chemotaxis protein
Location 287454 - 288539 (strand: 1)
Length 1086 (nucleotides) / 361 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1445
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00015 Methyl-accepting chemotaxis protein (MCP) signalling domain
PF13682 Chemoreceptor zinc-binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0840 Signal transduction mechanisms (T) T Methyl-accepting chemotaxis protein (MCP)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03406 methyl-accepting chemotaxis protein Two-component system
Bacterial chemotaxis		 -

Protein Sequence

MLKKIKSWASSRQTLHVRQPDNIEIFQKRLSEAAGVCAGNEPAASPDIQQNGHGDMLCRHLLEGISAIEIIRNSLLDSSNRLASEQSTLDEMTHHNGETRQHMHELNDVLDDISEHADKGLDYTKKLVFTLEQINQNIDNIERLSNQTNLLAVNSAIEASHVGSRGAGFSVISREIKQLSGEIQVEATTITSFTGKIQSHAHHIHTDAKDNQKLVASIRNIAVQAESRLQNMITCSSRMQAIIHFVAIQQFLNTVKLDHVIWKGDIYSRLLDENADLLVNDHTQCRLGKWYYADEGQKFISHDAYRRLEEPHKTVHLSGRKALEARAQGCRRDEEMYLGEMESASRSVIQHIDNLLESISY

Flanking regions ( +/- flanking 50bp)

TTTCGTTATTTTTTTATTTTCATTTTTATGGCGGAGGAGCCGGGGATCACATGCTGAAAAAAATAAAAAGTTGGGCATCTTCGCGTCAGACATTGCATGTCAGACAACCGGATAATATAGAAATTTTTCAGAAACGATTGAGTGAGGCAGCCGGTGTATGTGCCGGAAATGAACCGGCTGCAAGTCCGGATATTCAGCAGAACGGGCACGGTGATATGTTGTGCCGTCATCTTCTGGAAGGTATCAGCGCGATTGAAATTATCCGTAACTCGTTGCTGGATTCAAGTAACCGGCTGGCCAGTGAGCAGAGTACGCTTGATGAAATGACACACCATAATGGCGAAACCCGCCAGCATATGCATGAGCTTAATGATGTGCTGGATGACATCAGTGAACATGCGGACAAAGGGCTGGATTACACAAAAAAACTGGTTTTTACACTGGAACAAATCAATCAGAATATCGATAATATTGAGCGGCTGTCTAACCAGACAAACCTGCTGGCAGTCAACTCGGCGATAGAGGCTTCTCATGTCGGCAGCCGGGGCGCGGGGTTCTCTGTTATTTCCCGTGAGATAAAGCAATTGTCGGGTGAAATTCAGGTAGAAGCGACCACGATCACCTCTTTTACCGGTAAAATTCAGTCTCATGCGCATCATATTCATACCGATGCGAAAGATAACCAGAAATTAGTGGCGAGTATTCGTAATATTGCGGTGCAGGCAGAAAGTCGTCTGCAAAATATGATCACCTGTTCATCCAGAATGCAGGCCATTATCCACTTTGTTGCTATTCAGCAGTTTCTTAATACGGTCAAGCTGGATCATGTTATCTGGAAAGGCGATATCTACAGCCGGTTGCTGGATGAGAATGCAGATTTGCTTGTTAATGATCATACTCAGTGCCGGCTGGGAAAGTGGTATTACGCAGATGAAGGGCAGAAATTTATCAGTCATGATGCATACCGCCGGCTGGAAGAACCGCATAAAACAGTACATTTGTCCGGGCGTAAAGCGTTGGAAGCCCGTGCTCAGGGGTGCAGGCGTGATGAAGAAATGTATTTGGGGGAGATGGAAAGTGCCAGCCGCAGTGTTATTCAGCACATTGATAACTTACTAGAATCAATAAGTTATTAGAAGGTGTTATCAGGTCCGAATAGAAAAAAGCATCGCAGTGCGATGCTTTC