Homologs in group_2661

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04640 FBDBKF_04640 92.4 Morganella morganii S1 mtnA S-methyl-5-thioribose-1-phosphate isomerase
EHELCC_05930 EHELCC_05930 92.4 Morganella morganii S2 mtnA S-methyl-5-thioribose-1-phosphate isomerase
NLDBIP_06250 NLDBIP_06250 92.4 Morganella morganii S4 mtnA S-methyl-5-thioribose-1-phosphate isomerase
LHKJJB_03130 LHKJJB_03130 92.4 Morganella morganii S3 mtnA S-methyl-5-thioribose-1-phosphate isomerase
HKOGLL_06605 HKOGLL_06605 92.4 Morganella morganii S5 mtnA S-methyl-5-thioribose-1-phosphate isomerase

Distribution of the homologs in the orthogroup group_2661

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2661

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B7NGT8 0.0 530 69 1 362 3 mtnA Methylthioribose-1-phosphate isomerase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7MMH6 0.0 530 69 1 362 1 mtnA Methylthioribose-1-phosphate isomerase Escherichia coli O45:K1 (strain S88 / ExPEC)
A6ULQ4 6.9e-166 471 64 1 362 3 mtnA Methylthioribose-1-phosphate isomerase Sinorhizobium medicae (strain WSM419)
Q92TI2 1.32e-164 467 64 1 362 3 mtnA Methylthioribose-1-phosphate isomerase Rhizobium meliloti (strain 1021)
A6X8E9 3.63e-163 464 62 1 362 3 mtnA Methylthioribose-1-phosphate isomerase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q2VZP8 3.3e-161 459 65 2 362 3 mtnA Methylthioribose-1-phosphate isomerase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B8ES44 4.01e-153 438 58 1 362 3 mtnA Methylthioribose-1-phosphate isomerase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B9KQ55 1.27e-152 437 64 4 362 3 mtnA Methylthioribose-1-phosphate isomerase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
B7KZ66 2.43e-151 434 58 2 362 3 mtnA Methylthioribose-1-phosphate isomerase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B8IEX1 1.24e-149 429 59 2 362 3 mtnA Methylthioribose-1-phosphate isomerase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q5FQK0 1.87e-149 429 59 2 363 3 mtnA Methylthioribose-1-phosphate isomerase Gluconobacter oxydans (strain 621H)
Q2RXI0 1.76e-143 415 60 3 370 1 mtnA Methylthioribose-1-phosphate isomerase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B1ZL76 3.44e-143 413 58 2 362 3 mtnA Methylthioribose-1-phosphate isomerase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A5FUV7 1.17e-140 407 60 3 363 3 mtnA Methylthioribose-1-phosphate isomerase Acidiphilium cryptum (strain JF-5)
B6IUC1 1.63e-139 404 56 2 362 3 mtnA Methylthioribose-1-phosphate isomerase Rhodospirillum centenum (strain ATCC 51521 / SW)
B8FLU0 6.62e-121 357 52 7 368 3 mtnA Methylthioribose-1-phosphate isomerase Desulfatibacillum aliphaticivorans
Q47AR7 1.72e-117 348 53 2 361 3 mtnA Methylthioribose-1-phosphate isomerase Dechloromonas aromatica (strain RCB)
A8ZYA5 2.84e-117 347 52 4 359 3 mtnA Methylthioribose-1-phosphate isomerase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q30P36 6.13e-115 341 49 6 361 3 mtnA Methylthioribose-1-phosphate isomerase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A4XKS3 3.61e-84 262 44 8 340 3 mtnA Methylthioribose-1-phosphate isomerase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q5N076 5.33e-83 259 45 9 346 3 mtnA Methylthioribose-1-phosphate isomerase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31LP7 5.33e-83 259 45 9 346 3 mtnA Methylthioribose-1-phosphate isomerase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B9LBK4 1.63e-80 253 44 8 349 3 mtnA Methylthioribose-1-phosphate isomerase Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WGQ8 1.63e-80 253 44 8 349 3 mtnA Methylthioribose-1-phosphate isomerase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A8F3A3 4.41e-80 251 43 7 350 3 mtnA1 Methylthioribose-1-phosphate isomerase 1 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q028S4 1.62e-78 248 44 7 338 3 mtnA Methylthioribose-1-phosphate isomerase Solibacter usitatus (strain Ellin6076)
A3DD27 4.99e-78 246 44 8 342 3 mtnA Methylthioribose-1-phosphate isomerase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A9AYL1 9.64e-78 246 43 7 337 3 mtnA Methylthioribose-1-phosphate isomerase Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q57896 1.26e-77 244 42 7 355 3 MJ0454 Putative methylthioribose-1-phosphate isomerase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A7NFR2 2.94e-77 244 45 10 357 3 mtnA Methylthioribose-1-phosphate isomerase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
B0C8J2 3.26e-77 244 44 10 349 3 mtnA Methylthioribose-1-phosphate isomerase Acaryochloris marina (strain MBIC 11017)
B9LZ20 8e-77 243 42 8 355 3 mtnA Methylthioribose-1-phosphate isomerase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q39ZK3 1.27e-76 243 42 7 351 3 mtnA Methylthioribose-1-phosphate isomerase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A5G9J7 2.46e-76 242 41 7 351 3 mtnA Methylthioribose-1-phosphate isomerase Geotalea uraniireducens (strain Rf4)
O67879 2.78e-76 245 46 7 335 3 mtnA Methylthioribose-1-phosphate isomerase Aquifex aeolicus (strain VF5)
Q746Y8 1.47e-75 240 42 7 344 3 mtnA Methylthioribose-1-phosphate isomerase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
C0QUC0 5.56e-75 239 41 7 352 3 mtnA Methylthioribose-1-phosphate isomerase Persephonella marina (strain DSM 14350 / EX-H1)
A8YD90 3.83e-74 236 43 9 346 3 mtnA Methylthioribose-1-phosphate isomerase Microcystis aeruginosa
Q9X013 4.39e-74 236 43 8 342 1 mtnA Methylthioribose-1-phosphate isomerase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B5YGA0 4.76e-74 236 42 7 338 3 mtnA Methylthioribose-1-phosphate isomerase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A5UQK6 5.29e-74 236 43 9 353 3 mtnA Methylthioribose-1-phosphate isomerase Roseiflexus sp. (strain RS-1)
B0JPT8 6.15e-74 236 43 10 346 3 mtnA Methylthioribose-1-phosphate isomerase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q81IK7 6.26e-74 236 42 8 351 3 drdI 5-deoxyribose 1-phosphate isomerase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A9VRK3 6.75e-74 236 42 7 351 3 drdI 5-deoxyribose 1-phosphate isomerase Bacillus mycoides (strain KBAB4)
Q81ZC2 6.97e-74 236 42 8 351 3 drdI 5-deoxyribose 1-phosphate isomerase Bacillus anthracis
A0R946 6.97e-74 236 42 8 351 3 drdI 5-deoxyribose 1-phosphate isomerase Bacillus thuringiensis (strain Al Hakam)
Q63GN3 9.36e-74 235 43 8 351 3 drdI 5-deoxyribose 1-phosphate isomerase Bacillus cereus (strain ZK / E33L)
A8F7V1 1.16e-73 235 41 8 350 3 mtnA2 Methylthioribose-1-phosphate isomerase 2 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
B1LC23 2.03e-73 234 43 8 342 3 mtnA Methylthioribose-1-phosphate isomerase Thermotoga sp. (strain RQ2)
A5IIM2 2.03e-73 234 43 8 342 3 mtnA Methylthioribose-1-phosphate isomerase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q3M785 2.99e-73 234 42 8 351 3 mtnA Methylthioribose-1-phosphate isomerase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
C1FKZ3 5.31e-73 233 42 9 344 3 drdI 5-deoxyribose 1-phosphate isomerase Clostridium botulinum (strain Kyoto / Type A2)
B2V8N9 6.22e-73 233 42 7 329 3 mtnA Methylthioribose-1-phosphate isomerase Sulfurihydrogenibium sp. (strain YO3AOP1)
B7IFW5 7.17e-73 233 42 9 354 3 mtnA Methylthioribose-1-phosphate isomerase Thermosipho africanus (strain TCF52B)
Q6HP54 8.49e-73 233 42 8 351 3 drdI 5-deoxyribose 1-phosphate isomerase Bacillus thuringiensis subsp. konkukian (strain 97-27)
B1KZY3 9.92e-73 233 42 8 345 3 drdI 5-deoxyribose 1-phosphate isomerase Clostridium botulinum (strain Loch Maree / Type A3)
P0DTQ1 1.06e-72 233 41 8 351 1 drdI 5-deoxyribose 1-phosphate isomerase Bacillus thuringiensis serovar kurstaki (strain ATCC 35866 / NRRL B-4488 / HD73)
A7HIG6 1.11e-72 232 44 7 344 3 mtnA Methylthioribose-1-phosphate isomerase Anaeromyxobacter sp. (strain Fw109-5)
A1ALC1 1.37e-72 232 42 7 340 3 mtnA Methylthioribose-1-phosphate isomerase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q21S04 2.05e-72 232 44 7 336 3 mtnA Methylthioribose-1-phosphate isomerase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A6LJM7 2.11e-72 232 41 8 354 3 mtnA Methylthioribose-1-phosphate isomerase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
C5D7U5 2.18e-72 232 41 8 341 3 mtnA Methylthioribose-1-phosphate isomerase Geobacillus sp. (strain WCH70)
Q1ISH2 2.21e-72 232 43 10 343 3 mtnA Methylthioribose-1-phosphate isomerase Koribacter versatilis (strain Ellin345)
Q8DK09 2.59e-72 232 41 7 352 3 mtnA Methylthioribose-1-phosphate isomerase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A7HN79 3.41e-72 231 41 9 359 3 mtnA Methylthioribose-1-phosphate isomerase Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
A7GCV8 3.5e-72 231 42 9 344 3 drdI 5-deoxyribose 1-phosphate isomerase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5I1A6 5.87e-72 231 42 9 344 3 drdI 5-deoxyribose 1-phosphate isomerase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FTE6 5.87e-72 231 42 9 344 3 drdI 5-deoxyribose 1-phosphate isomerase Clostridium botulinum (strain ATCC 19397 / Type A)
B2J5P6 6.81e-72 231 41 12 360 3 mtnA Methylthioribose-1-phosphate isomerase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
B9KA57 1.02e-71 230 43 7 337 3 mtnA Methylthioribose-1-phosphate isomerase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q8YR82 1.51e-71 229 42 7 336 3 mtnA Methylthioribose-1-phosphate isomerase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B3E3M5 1.54e-71 229 41 7 342 3 mtnA Methylthioribose-1-phosphate isomerase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
C3KTV5 1.74e-71 229 41 8 345 3 drdI 5-deoxyribose 1-phosphate isomerase Clostridium botulinum (strain 657 / Type Ba4)
Q635P7 1.77e-71 229 42 8 343 3 mtnA Methylthioribose-1-phosphate isomerase Bacillus cereus (strain ZK / E33L)
Q81MJ6 1.79e-71 229 42 8 343 3 mtnA Methylthioribose-1-phosphate isomerase Bacillus anthracis
B1IJF0 2.68e-71 229 41 9 344 3 drdI 5-deoxyribose 1-phosphate isomerase Clostridium botulinum (strain Okra / Type B1)
C6E6Z4 2.94e-71 229 43 8 351 3 mtnA Methylthioribose-1-phosphate isomerase Geobacter sp. (strain M21)
B1XJK0 3.07e-71 229 42 8 338 3 mtnA Methylthioribose-1-phosphate isomerase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q6HED3 5.65e-71 228 41 8 343 3 mtnA Methylthioribose-1-phosphate isomerase Bacillus thuringiensis subsp. konkukian (strain 97-27)
A0RI38 8.68e-71 228 41 8 343 3 mtnA Methylthioribose-1-phosphate isomerase Bacillus thuringiensis (strain Al Hakam)
Q113K5 1.54e-70 227 41 8 337 3 mtnA Methylthioribose-1-phosphate isomerase Trichodesmium erythraeum (strain IMS101)
Q3ABU6 2.25e-70 226 45 8 337 3 mtnA Methylthioribose-1-phosphate isomerase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B5ED21 2.79e-70 226 43 8 351 3 mtnA Methylthioribose-1-phosphate isomerase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q7UF90 3.81e-70 226 44 8 337 3 mtnA Methylthioribose-1-phosphate isomerase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q731R7 4.91e-70 226 41 8 343 3 mtnA Methylthioribose-1-phosphate isomerase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q819F2 5.73e-70 226 41 8 343 3 mtnA Methylthioribose-1-phosphate isomerase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A0L909 1.03e-69 225 41 6 338 3 mtnA Methylthioribose-1-phosphate isomerase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B1I2P1 2.07e-69 224 43 7 338 3 mtnA Methylthioribose-1-phosphate isomerase Desulforudis audaxviator (strain MP104C)
Q24UA0 6.48e-69 223 45 6 342 3 mtnA Methylthioribose-1-phosphate isomerase Desulfitobacterium hafniense (strain Y51)
B8FRM1 7.21e-69 223 45 6 342 3 mtnA Methylthioribose-1-phosphate isomerase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B2A5S2 1.68e-68 222 40 8 340 3 mtnA Methylthioribose-1-phosphate isomerase Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q2RKL8 1.82e-68 222 45 8 340 3 drdI 5-deoxyribose 1-phosphate isomerase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q5L1E6 1.89e-68 222 42 8 356 3 mtnA Methylthioribose-1-phosphate isomerase Geobacillus kaustophilus (strain HTA426)
P74497 5.33e-68 221 41 8 339 3 mtnA Methylthioribose-1-phosphate isomerase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A4ILL1 8.69e-68 220 42 9 342 3 mtnA Methylthioribose-1-phosphate isomerase Geobacillus thermodenitrificans (strain NG80-2)
Q3AWF5 1.01e-67 219 41 8 337 3 mtnA Methylthioribose-1-phosphate isomerase Synechococcus sp. (strain CC9902)
Q2LXN1 2.42e-67 219 40 8 357 3 mtnA Methylthioribose-1-phosphate isomerase Syntrophus aciditrophicus (strain SB)
Q8R9L7 7.9e-67 218 42 7 337 3 mtnA Methylthioribose-1-phosphate isomerase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q7NP62 2.29e-66 216 42 7 336 3 mtnA Methylthioribose-1-phosphate isomerase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B0K2V6 3.06e-66 216 42 7 340 3 mtnA Methylthioribose-1-phosphate isomerase Thermoanaerobacter sp. (strain X514)
B0K8S2 3.06e-66 216 42 7 340 3 mtnA Methylthioribose-1-phosphate isomerase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B1WQH2 3.19e-66 216 41 10 340 3 mtnA Methylthioribose-1-phosphate isomerase Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q3AMB7 3.95e-66 215 42 7 333 3 mtnA Methylthioribose-1-phosphate isomerase Synechococcus sp. (strain CC9605)
A9BHC5 1.13e-65 214 40 9 355 3 mtnA Methylthioribose-1-phosphate isomerase Petrotoga mobilis (strain DSM 10674 / SJ95)
A6T656 1.42e-65 214 43 10 357 3 mtnA Methylthioribose-1-phosphate isomerase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q66E16 3.13e-65 213 44 9 339 3 mtnA Methylthioribose-1-phosphate isomerase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K633 3.13e-65 213 44 9 339 3 mtnA Methylthioribose-1-phosphate isomerase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A4J678 3.88e-65 213 43 9 339 3 mtnA Methylthioribose-1-phosphate isomerase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B5XZW2 4.07e-65 213 43 10 357 3 mtnA Methylthioribose-1-phosphate isomerase Klebsiella pneumoniae (strain 342)
Q65KK2 6.87e-65 213 39 12 364 3 mtnA Methylthioribose-1-phosphate isomerase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A9KIE9 1.48e-64 212 39 8 352 3 drdI 5-deoxyribose 1-phosphate isomerase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
O31662 3.43e-64 211 39 8 347 1 mtnA Methylthioribose-1-phosphate isomerase Bacillus subtilis (strain 168)
O29877 3.75e-64 210 42 10 335 1 AF_0370 Putative methylthioribose-1-phosphate isomerase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O27900 4.92e-64 209 40 8 332 3 MTH_1872 Putative methylthioribose-1-phosphate isomerase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A9UQ62 7.63e-64 210 39 10 353 3 34861 Methylthioribose-1-phosphate isomerase Monosiga brevicollis
B1JIK3 1.65e-63 209 44 9 339 3 mtnA Methylthioribose-1-phosphate isomerase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TPM9 1.65e-63 209 44 9 339 3 mtnA Methylthioribose-1-phosphate isomerase Yersinia pestis (strain Pestoides F)
A9R2Z5 1.65e-63 209 44 9 339 3 mtnA Methylthioribose-1-phosphate isomerase Yersinia pestis bv. Antiqua (strain Angola)
A7FLL1 1.65e-63 209 44 9 339 3 mtnA Methylthioribose-1-phosphate isomerase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q2NFJ6 1.66e-63 208 40 8 327 3 Msp_1023 Putative methylthioribose-1-phosphate isomerase Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
A9VFD5 1.84e-63 209 39 8 343 3 mtnA Methylthioribose-1-phosphate isomerase Bacillus mycoides (strain KBAB4)
A7Z3X0 2.54e-63 209 38 9 340 3 mtnA Methylthioribose-1-phosphate isomerase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A7MKX3 2.91e-63 208 44 8 329 3 mtnA Methylthioribose-1-phosphate isomerase Cronobacter sakazakii (strain ATCC BAA-894)
A5D1G8 3.67e-63 209 41 7 339 3 mtnA Methylthioribose-1-phosphate isomerase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q053E2 1.09e-62 207 39 11 355 3 mtnA Methylthioribose-1-phosphate isomerase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04RD6 1.09e-62 207 39 11 355 3 mtnA Methylthioribose-1-phosphate isomerase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
C6DCZ1 1.29e-62 206 43 9 337 3 mtnA Methylthioribose-1-phosphate isomerase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A8ANI3 1.35e-62 206 42 9 349 3 mtnA Methylthioribose-1-phosphate isomerase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
C1DRQ7 1.62e-62 207 40 6 335 3 mtnA Methylthioribose-1-phosphate isomerase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A4W7Z1 1.92e-62 206 42 9 349 3 mtnA Methylthioribose-1-phosphate isomerase Enterobacter sp. (strain 638)
A6LE92 3.37e-62 205 40 9 345 3 mtnA Methylthioribose-1-phosphate isomerase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q9HZ65 4.06e-62 206 40 7 338 3 mtnA Methylthioribose-1-phosphate isomerase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PX5 4.06e-62 206 40 7 338 3 mtnA Methylthioribose-1-phosphate isomerase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V9J7 4.06e-62 206 40 7 338 3 mtnA Methylthioribose-1-phosphate isomerase Pseudomonas aeruginosa (strain LESB58)
A8FCG5 1.06e-61 204 38 9 362 3 mtnA Methylthioribose-1-phosphate isomerase Bacillus pumilus (strain SAFR-032)
B0TH58 1.06e-61 204 44 6 339 3 mtnA Methylthioribose-1-phosphate isomerase Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q7U4V1 1.22e-61 204 40 7 336 3 mtnA Methylthioribose-1-phosphate isomerase Parasynechococcus marenigrum (strain WH8102)
Q3A2J8 1.33e-61 204 43 9 357 3 mtnA Methylthioribose-1-phosphate isomerase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
C1A6J9 2.12e-61 203 40 6 335 3 mtnA Methylthioribose-1-phosphate isomerase Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
A1VHH2 2.93e-61 203 40 10 346 3 mtnA Methylthioribose-1-phosphate isomerase Nitratidesulfovibrio vulgaris (strain DP4)
Q72FX9 2.93e-61 203 40 10 346 3 mtnA Methylthioribose-1-phosphate isomerase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q317L9 4.2e-61 203 40 9 342 3 mtnA Methylthioribose-1-phosphate isomerase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q0VPK6 6.05e-61 202 40 6 340 3 mtnA Methylthioribose-1-phosphate isomerase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B8GRR4 1.11e-60 202 40 9 342 3 mtnA Methylthioribose-1-phosphate isomerase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
B4UIU8 1.31e-60 201 42 6 332 3 mtnA Methylthioribose-1-phosphate isomerase Anaeromyxobacter sp. (strain K)
A6V2Q6 1.56e-60 201 39 6 335 3 mtnA Methylthioribose-1-phosphate isomerase Pseudomonas aeruginosa (strain PA7)
A8GAB1 1.87e-60 201 41 9 347 3 mtnA Methylthioribose-1-phosphate isomerase Serratia proteamaculans (strain 568)
Q67MP0 3.07e-60 201 41 10 356 3 mtnA Methylthioribose-1-phosphate isomerase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q8KBH1 3.25e-60 201 38 5 334 3 mtnA Methylthioribose-1-phosphate isomerase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A9BJF6 3.4e-60 200 39 9 360 3 drdI 5-deoxyribose 1-phosphate isomerase Petrotoga mobilis (strain DSM 10674 / SJ95)
Q3Z937 6.65e-60 199 39 8 337 3 mtnA Methylthioribose-1-phosphate isomerase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
B8J4S7 6.78e-60 201 39 7 335 3 mtnA Methylthioribose-1-phosphate isomerase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
A0LIZ1 9.72e-60 199 41 9 343 3 mtnA Methylthioribose-1-phosphate isomerase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q2IH96 9.87e-60 199 42 6 330 3 mtnA Methylthioribose-1-phosphate isomerase Anaeromyxobacter dehalogenans (strain 2CP-C)
D7TCD0 1.27e-59 200 40 7 344 2 VIT_11s0016g00830 Methylthioribose-1-phosphate isomerase Vitis vinifera
B8DQQ9 1.92e-59 198 40 8 339 3 mtnA Methylthioribose-1-phosphate isomerase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A4VLZ8 3.76e-59 198 39 6 341 3 mtnA Methylthioribose-1-phosphate isomerase Stutzerimonas stutzeri (strain A1501)
Q3K8T8 4.37e-59 198 40 6 335 3 mtnA Methylthioribose-1-phosphate isomerase Pseudomonas fluorescens (strain Pf0-1)
Q8U178 8.74e-59 197 41 9 350 3 PF1349 Putative methylthioribose-1-phosphate isomerase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
A1JP09 1.05e-58 196 41 9 339 3 mtnA Methylthioribose-1-phosphate isomerase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B9HCR2 1.25e-58 197 37 8 344 3 POPTRDRAFT_832064 Methylthioribose-1-phosphate isomerase Populus trichocarpa
Q9ZUG4 1.87e-58 197 41 9 340 1 At2g05830 Methylthioribose-1-phosphate isomerase Arabidopsis thaliana
C7Z638 5.89e-58 196 37 11 372 3 MRI1 Methylthioribose-1-phosphate isomerase Fusarium vanettenii (strain ATCC MYA-4622 / CBS 123669 / FGSC 9596 / NRRL 45880 / 77-13-4)
Q5YQZ6 6.41e-58 200 39 8 347 3 mtnAB Probable bifunctional methylthioribose-1-phosphate isomerase/methylthioribulose-1-phosphate dehydratase Nocardia farcinica (strain IFM 10152)
Q72JR1 9.18e-58 194 42 9 335 3 mtnA Methylthioribose-1-phosphate isomerase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B3RLE6 1.54e-57 194 36 9 362 3 TRIADDRAFT_19292 Methylthioribose-1-phosphate isomerase Trichoplax adhaerens
Q0AYV4 2.24e-57 193 37 8 348 3 mtnA Methylthioribose-1-phosphate isomerase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q5SJE2 2.4e-57 192 42 9 335 3 mtnA Methylthioribose-1-phosphate isomerase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
C6C0F7 3.9e-57 192 39 9 338 3 mtnA Methylthioribose-1-phosphate isomerase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q3BV11 8.31e-57 192 40 9 333 3 mtnA Methylthioribose-1-phosphate isomerase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
O58433 8.82e-57 192 40 8 340 1 PH0702 Putative methylthioribose-1-phosphate isomerase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8PM04 1.25e-56 191 40 9 333 3 mtnA Methylthioribose-1-phosphate isomerase Xanthomonas axonopodis pv. citri (strain 306)
Q5H060 1.83e-56 191 40 10 346 3 mtnA Methylthioribose-1-phosphate isomerase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SIW1 1.83e-56 191 40 10 346 3 mtnA Methylthioribose-1-phosphate isomerase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P337 1.83e-56 191 40 10 346 3 mtnA Methylthioribose-1-phosphate isomerase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PAB2 1.85e-56 191 39 8 333 3 mtnA Methylthioribose-1-phosphate isomerase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RUX9 1.85e-56 191 39 8 333 3 mtnA Methylthioribose-1-phosphate isomerase Xanthomonas campestris pv. campestris (strain B100)
Q4UTB3 1.85e-56 191 39 8 333 3 mtnA Methylthioribose-1-phosphate isomerase Xanthomonas campestris pv. campestris (strain 8004)
A1U3J9 3.04e-56 190 39 9 352 3 mtnA Methylthioribose-1-phosphate isomerase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q948X8 3.6e-56 191 39 8 340 2 CIG2 Methylthioribose-1-phosphate isomerase Nicotiana tabacum
B1YIY4 5.1e-56 189 38 8 341 3 mtnA Methylthioribose-1-phosphate isomerase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q3ZZT1 1.35e-55 188 37 8 343 3 mtnA Methylthioribose-1-phosphate isomerase Dehalococcoides mccartyi (strain CBDB1)
Q9UZ16 1.64e-55 188 40 10 364 3 aIF-2BI Putative methylthioribose-1-phosphate isomerase Pyrococcus abyssi (strain GE5 / Orsay)
A5FRU8 2.17e-55 187 37 8 343 3 mtnA Methylthioribose-1-phosphate isomerase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q48FM6 2.59e-55 188 39 8 340 3 mtnA Methylthioribose-1-phosphate isomerase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3J8U5 3.29e-55 187 39 7 366 3 mtnA Methylthioribose-1-phosphate isomerase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B9RR88 2.34e-54 186 39 8 340 2 RCOM_0711420 Methylthioribose-1-phosphate isomerase Ricinus communis
Q4ZQ92 3.47e-54 185 39 8 339 3 mtnA Methylthioribose-1-phosphate isomerase Pseudomonas syringae pv. syringae (strain B728a)
Q9PAG5 8.24e-54 184 37 9 348 3 mtnA Methylthioribose-1-phosphate isomerase Xylella fastidiosa (strain 9a5c)
B6TZD1 1.17e-53 184 37 9 346 2 IDI2 Methylthioribose-1-phosphate isomerase Zea mays
Q72T46 1.7e-53 183 35 8 355 3 mtnA Methylthioribose-1-phosphate isomerase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q87A92 1.91e-53 183 37 10 352 3 mtnA Methylthioribose-1-phosphate isomerase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9S0 1.91e-53 183 37 10 352 3 mtnA Methylthioribose-1-phosphate isomerase Xylella fastidiosa (strain M23)
Q2SE63 1.96e-53 182 42 7 332 3 mtnA Methylthioribose-1-phosphate isomerase Hahella chejuensis (strain KCTC 2396)
Q8F2A8 1.99e-53 183 35 8 355 3 mtnA Methylthioribose-1-phosphate isomerase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q885T7 2.64e-53 183 39 6 337 3 mtnA Methylthioribose-1-phosphate isomerase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4K8M6 2.7e-53 183 38 6 335 3 mtnA Methylthioribose-1-phosphate isomerase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q29BB3 3.73e-53 182 35 8 365 3 GA10928 Methylthioribose-1-phosphate isomerase Drosophila pseudoobscura pseudoobscura
Q8TUJ1 5.21e-53 182 38 10 348 3 MA_0076 Putative methylthioribose-1-phosphate isomerase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
B4GYU1 6.14e-53 182 35 8 365 3 GL27236 Methylthioribose-1-phosphate isomerase Drosophila persimilis
Q7PKS9 6.88e-53 181 36 7 337 3 AGAP001589 Methylthioribose-1-phosphate isomerase Anopheles gambiae
B0U5G3 7.59e-53 181 37 10 358 3 mtnA Methylthioribose-1-phosphate isomerase Xylella fastidiosa (strain M12)
B8C6V3 5.99e-52 179 34 7 360 3 THAPSDRAFT_35896 Methylthioribose-1-phosphate isomerase Thalassiosira pseudonana
B3M098 5.99e-52 179 35 9 367 3 GF17194 Methylthioribose-1-phosphate isomerase Drosophila ananassae
Q0ZB81 6.32e-52 179 35 9 360 2 None Methylthioribose-1-phosphate isomerase Bombyx mori
Q5HZE4 7.62e-52 179 36 11 365 1 Mri1 Methylthioribose-1-phosphate isomerase Rattus norvegicus
Q16I17 8.37e-52 179 34 7 361 3 AAEL013828 Methylthioribose-1-phosphate isomerase Aedes aegypti
A7GS56 1.21e-51 178 39 8 340 3 mtnA Methylthioribose-1-phosphate isomerase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q4FZP2 1.48e-51 178 36 7 339 2 mri1 Methylthioribose-1-phosphate isomerase Xenopus laevis
A4XTE5 2.64e-51 177 40 8 337 3 mtnA Methylthioribose-1-phosphate isomerase Pseudomonas mendocina (strain ymp)
C9SB02 2.66e-51 178 35 8 371 3 MRI1 Methylthioribose-1-phosphate isomerase Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136)
Q0AA70 2.77e-51 177 41 8 352 3 mtnA Methylthioribose-1-phosphate isomerase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q9CQT1 3.81e-51 177 37 8 342 1 Mri1 Methylthioribose-1-phosphate isomerase Mus musculus
B4JRX2 5.76e-51 177 36 9 352 3 GH21593 Methylthioribose-1-phosphate isomerase Drosophila grimshawi
C5FY68 6.77e-51 177 35 10 383 3 MRI1 Methylthioribose-1-phosphate isomerase Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
Q5B590 8.5e-51 177 35 9 369 3 mri1 Methylthioribose-1-phosphate isomerase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B4PNE2 2.13e-50 175 35 9 369 3 GE23315 Methylthioribose-1-phosphate isomerase Drosophila yakuba
A4S068 2.2e-50 175 37 10 360 3 OSTLU_35743 Methylthioribose-1-phosphate isomerase Ostreococcus lucimarinus (strain CCE9901)
Q0VFN1 2.79e-50 175 36 7 339 2 mri1 Methylthioribose-1-phosphate isomerase Xenopus tropicalis
Q9AYT7 4.05e-50 175 37 10 340 2 IDI2 Methylthioribose-1-phosphate isomerase Hordeum vulgare
B4QSM8 4.14e-50 174 35 9 367 3 GD16414 Methylthioribose-1-phosphate isomerase Drosophila simulans
Q9V9X4 6.59e-50 174 35 10 367 2 CG11334 Methylthioribose-1-phosphate isomerase Drosophila melanogaster
B6H5R4 7.23e-50 174 37 9 359 3 mri1 Methylthioribose-1-phosphate isomerase Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
A7RF00 8.1e-50 173 37 9 336 3 v1g237765 Methylthioribose-1-phosphate isomerase Nematostella vectensis
B0SNY3 1.06e-49 173 34 9 341 3 mtnA Methylthioribose-1-phosphate isomerase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SFD6 1.06e-49 173 34 9 341 3 mtnA Methylthioribose-1-phosphate isomerase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A4ICE5 1.13e-49 174 35 7 342 3 LinJ36.0740 Methylthioribose-1-phosphate isomerase Leishmania infantum
B4I029 1.3e-49 173 35 9 367 3 GM12085 Methylthioribose-1-phosphate isomerase Drosophila sechellia
A9FD66 1.37e-49 172 41 9 335 3 mtnA Methylthioribose-1-phosphate isomerase Sorangium cellulosum (strain So ce56)
B3P538 1.5e-49 173 35 9 368 3 GG11866 Methylthioribose-1-phosphate isomerase Drosophila erecta
P0CN40 3.21e-49 173 35 8 366 3 MRI1 Methylthioribose-1-phosphate isomerase Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CN41 4.31e-49 172 35 8 366 3 MRI1 Methylthioribose-1-phosphate isomerase Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
A4HQ10 5.73e-49 172 36 9 346 3 LbrM35_V2.5180 Methylthioribose-1-phosphate isomerase Leishmania braziliensis
C4JWQ7 6.21e-49 172 35 10 371 3 MRI1 Methylthioribose-1-phosphate isomerase Uncinocarpus reesii (strain UAMH 1704)
Q1IDA4 8.01e-49 171 37 6 335 3 mtnA Methylthioribose-1-phosphate isomerase Pseudomonas entomophila (strain L48)
B4NG41 9.38e-49 171 34 10 366 3 GK22419 Methylthioribose-1-phosphate isomerase Drosophila willistoni
B8M7D2 1.21e-48 171 33 8 372 3 mri1 Methylthioribose-1-phosphate isomerase Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
B4LWZ8 1.39e-48 171 35 9 363 3 GJ22917 Methylthioribose-1-phosphate isomerase Drosophila virilis
B4K8A4 3.2e-48 169 35 9 358 3 GI10562 Methylthioribose-1-phosphate isomerase Drosophila mojavensis
A2ZCP0 4.21e-48 169 36 8 346 2 OsI_35550 Methylthioribose-1-phosphate isomerase Oryza sativa subsp. indica
A6RHT9 6.07e-48 171 34 12 405 3 mri1 Methylthioribose-1-phosphate isomerase Botryotinia fuckeliana (strain B05.10)
Q4Q0R9 6.16e-48 169 36 7 342 1 LmjF36.4930 Methylthioribose-1-phosphate isomerase Leishmania major
Q2GM68 7.49e-48 169 34 11 377 3 MRI1 Methylthioribose-1-phosphate isomerase Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
Q0ITU1 9.47e-48 169 36 8 346 2 IDI2 Methylthioribose-1-phosphate isomerase Oryza sativa subsp. japonica
B2FKI7 9.78e-48 168 38 11 347 3 mtnA Methylthioribose-1-phosphate isomerase Stenotrophomonas maltophilia (strain K279a)
O60185 1.02e-47 168 36 8 333 3 mri1 Methylthioribose-1-phosphate isomerase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B2VZQ8 1.08e-47 169 37 12 376 3 mri1 Methylthioribose-1-phosphate isomerase Pyrenophora tritici-repentis (strain Pt-1C-BFP)
Q4JB92 2.48e-47 167 34 8 346 3 Saci_0539 Putative methylthioribose-1-phosphate isomerase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q9BV20 3.18e-47 167 36 9 342 1 MRI1 Methylthioribose-1-phosphate isomerase Homo sapiens
B4SP84 5.13e-47 166 38 11 352 3 mtnA Methylthioribose-1-phosphate isomerase Stenotrophomonas maltophilia (strain R551-3)
C5PBM5 6.27e-47 167 34 8 355 3 MRI1 Methylthioribose-1-phosphate isomerase Coccidioides posadasii (strain C735)
P23140 7.23e-47 160 51 2 178 3 None Uncharacterized protein in petC 3'region (Fragment) Rhodospirillum rubrum
A1CY38 8.47e-47 166 38 11 360 3 mri1 Methylthioribose-1-phosphate isomerase Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
A5DUX4 9.08e-47 167 32 10 392 3 MRI1 Methylthioribose-1-phosphate isomerase Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239)
Q2NL31 1.17e-46 165 37 9 342 2 MRI1 Methylthioribose-1-phosphate isomerase Bos taurus
B6QRG1 1.34e-46 166 33 9 385 3 mri1 Methylthioribose-1-phosphate isomerase Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
D0A8W2 1.54e-46 166 35 9 362 3 TbgDal_XI12320 Methylthioribose-1-phosphate isomerase Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972)
Q383H9 1.61e-46 166 35 9 362 3 Tb11.01.2780 Methylthioribose-1-phosphate isomerase Trypanosoma brucei brucei (strain 927/4 GUTat10.1)
Q4CY36 3.38e-46 164 37 10 349 3 Tc00.1047053503971.40 Methylthioribose-1-phosphate isomerase 1 Trypanosoma cruzi (strain CL Brener)
A7EGZ3 5.42e-46 166 34 12 406 3 mri1 Methylthioribose-1-phosphate isomerase Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)
Q2UIM3 7.87e-46 164 36 9 366 3 mri1 Methylthioribose-1-phosphate isomerase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q9YE84 7.89e-46 164 37 8 338 3 APE_0686 Putative methylthioribose-1-phosphate isomerase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q6CGS4 8.8e-46 163 32 6 351 3 MRI1 Methylthioribose-1-phosphate isomerase Yarrowia lipolytica (strain CLIB 122 / E 150)
C5M614 1.76e-45 164 32 12 396 3 MRI1 Methylthioribose-1-phosphate isomerase Candida tropicalis (strain ATCC MYA-3404 / T1)
Q4WNI1 3.16e-45 162 37 11 364 3 mri1 Methylthioribose-1-phosphate isomerase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
B0Y5C3 3.16e-45 162 37 11 364 3 mri1 Methylthioribose-1-phosphate isomerase Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)
D2VAA9 3.34e-45 162 35 9 344 3 NAEGRDRAFT_32363 Methylthioribose-1-phosphate isomerase Naegleria gruberi
Q4D6B2 4.39e-45 162 36 9 349 3 Tc00.1047053508269.30 Methylthioribose-1-phosphate isomerase 2 Trypanosoma cruzi (strain CL Brener)
A9JRE2 4.95e-45 161 33 11 373 2 mri1 Methylthioribose-1-phosphate isomerase Danio rerio
Q88M09 5.86e-45 161 37 8 335 3 mtnA Methylthioribose-1-phosphate isomerase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
C0P108 5.96e-45 162 34 8 372 3 MRI1 Methylthioribose-1-phosphate isomerase Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432)
B2AML6 7.21e-45 162 35 10 375 3 MRI1 Methylthioribose-1-phosphate isomerase Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383)
A1WUJ7 7.63e-45 160 40 10 350 3 mtnA Methylthioribose-1-phosphate isomerase Halorhodospira halophila (strain DSM 244 / SL1)
P0CI29 1.9e-44 160 34 10 376 3 MRI1 Methylthioribose-1-phosphate isomerase Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell)
A6R364 2.23e-44 160 35 9 373 3 MRI1 Methylthioribose-1-phosphate isomerase Ajellomyces capsulatus (strain NAm1 / WU24)
B8PBR2 2.57e-44 160 33 10 360 3 MRI1 Methylthioribose-1-phosphate isomerase Postia placenta (strain ATCC 44394 / Madison 698-R)
C4YJ78 2.69e-44 160 33 14 400 3 MRI1 Methylthioribose-1-phosphate isomerase Candida albicans (strain WO-1)
Q5AD59 4.12e-44 160 33 14 400 3 MRI1 Methylthioribose-1-phosphate isomerase Candida albicans (strain SC5314 / ATCC MYA-2876)
C1G9Q3 9.18e-44 158 34 9 358 3 MRI1 Methylthioribose-1-phosphate isomerase Paracoccidioides brasiliensis (strain Pb18)
B1J5G5 1.27e-43 157 36 8 335 3 mtnA Methylthioribose-1-phosphate isomerase Pseudomonas putida (strain W619)
Q7S4G7 1.49e-43 158 33 10 376 3 mri-1 Methylthioribose-1-phosphate isomerase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
B9WAG5 2.4e-43 158 32 13 408 3 MRI1 Methylthioribose-1-phosphate isomerase Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841)
B0D0U4 2.56e-43 157 34 10 359 3 MRI1 Methylthioribose-1-phosphate isomerase Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686)
A8XDI8 1.02e-42 155 32 10 366 3 CBG11572 Methylthioribose-1-phosphate isomerase Caenorhabditis briggsae
Q0CFY3 1.19e-42 155 37 10 366 3 mri1 Methylthioribose-1-phosphate isomerase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
C0S1C8 2.42e-42 155 33 9 362 3 MRI1 Methylthioribose-1-phosphate isomerase Paracoccidioides brasiliensis (strain Pb03)
B6K4Q2 1.25e-41 152 35 8 350 3 mri1 Methylthioribose-1-phosphate isomerase Schizosaccharomyces japonicus (strain yFS275 / FY16936)
C7GXT0 4.91e-41 152 30 10 398 3 MRI1 Methylthioribose-1-phosphate isomerase Saccharomyces cerevisiae (strain JAY291)
C5JGS0 5.11e-41 151 34 11 374 3 MRI1 Methylthioribose-1-phosphate isomerase Blastomyces gilchristii (strain SLH14081)
Q93169 5.16e-41 150 32 8 342 3 C01G10.9 Methylthioribose-1-phosphate isomerase Caenorhabditis elegans
C5GGE5 5.38e-41 151 34 11 374 3 MRI1 Methylthioribose-1-phosphate isomerase Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586)
A5W7G2 5.4e-41 150 37 7 335 3 mtnA Methylthioribose-1-phosphate isomerase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q06489 6.43e-41 151 30 10 398 1 MRI1 Methylthioribose-1-phosphate isomerase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
C8ZJE0 6.43e-41 151 30 10 398 3 MRI1 Methylthioribose-1-phosphate isomerase Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse)
A6ZWZ9 6.43e-41 151 30 10 398 3 MRI1 Methylthioribose-1-phosphate isomerase Saccharomyces cerevisiae (strain YJM789)
B5VTQ8 6.43e-41 151 30 10 398 3 MRI1 Methylthioribose-1-phosphate isomerase Saccharomyces cerevisiae (strain AWRI1631)
B3LK82 6.43e-41 151 30 10 398 3 MRI1 Methylthioribose-1-phosphate isomerase Saccharomyces cerevisiae (strain RM11-1a)
Q6FVY2 7.47e-41 151 29 8 394 3 MRI1 Methylthioribose-1-phosphate isomerase Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q606P2 1.37e-40 149 36 8 335 3 mtnA Methylthioribose-1-phosphate isomerase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1CGN9 1.68e-40 150 36 10 358 3 mri1 Methylthioribose-1-phosphate isomerase Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
C5DHL1 6.6e-40 149 29 7 397 3 MRI1 Methylthioribose-1-phosphate isomerase Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)
B0KTX5 1.36e-39 147 37 7 335 3 mtnA Methylthioribose-1-phosphate isomerase Pseudomonas putida (strain GB-1)
A3LN21 1.38e-39 148 30 10 394 3 MRI1 Methylthioribose-1-phosphate isomerase Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
Q6BZH5 1.88e-39 147 30 11 390 3 MRI1 Methylthioribose-1-phosphate isomerase Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
A7TSA5 1.92e-39 147 29 10 402 3 MRI1 Methylthioribose-1-phosphate isomerase Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294 / BCRC 21397 / CBS 2163 / NBRC 10782 / NRRL Y-8283 / UCD 57-17)
A5DNT0 4.82e-39 146 31 12 379 3 MRI1 Methylthioribose-1-phosphate isomerase Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324)
C4YC37 2.03e-38 144 31 12 384 3 MRI1 Methylthioribose-1-phosphate isomerase Clavispora lusitaniae (strain ATCC 42720)
Q75EI1 1.52e-37 142 31 10 385 3 MRI1 Methylthioribose-1-phosphate isomerase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q6CQP3 3.64e-37 141 29 8 381 3 MRI1 Methylthioribose-1-phosphate isomerase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
C4QYS6 1.7e-36 139 30 13 390 3 MRI1 Methylthioribose-1-phosphate isomerase Komagataella phaffii (strain GS115 / ATCC 20864)
Q57586 6.76e-36 135 34 12 327 3 MJ0122 Ribose 1,5-bisphosphate isomerase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
C5DU12 4.74e-32 127 27 9 385 3 MRI1 Methylthioribose-1-phosphate isomerase Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229)
Q5JFM9 1.62e-31 124 34 10 318 1 TK0185 Ribose 1,5-bisphosphate isomerase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q9V281 2.91e-31 124 33 11 319 3 PYRAB01930 Ribose 1,5-bisphosphate isomerase Pyrococcus abyssi (strain GE5 / Orsay)
O28242 4.69e-31 123 34 9 309 3 AF_2037 Ribose 1,5-bisphosphate isomerase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q8U4G6 1.94e-30 121 33 12 319 3 PF0122 Ribose 1,5-bisphosphate isomerase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O57947 1.16e-29 119 35 10 276 1 PH0208 Ribose 1,5-bisphosphate isomerase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
D4GV73 4.4e-23 101 32 9 309 1 HVO_0966 Ribose 1,5-bisphosphate isomerase Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
D2RW80 6.88e-21 95 32 8 275 1 Htur_0571 Ribose 1,5-bisphosphate isomerase Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / JCM 9101 / NCIMB 13204 / VKM B-1734 / 4k)
P34604 5.16e-14 75 34 4 138 1 ZK1098.4 Translation initiation factor eIF2B subunit alpha Caenorhabditis elegans
Q54I81 4.39e-13 72 30 7 207 3 eif2b1 Translation initiation factor eIF2B subunit alpha Dictyostelium discoideum
O58185 7.56e-12 68 31 3 174 1 PH0440 Putative translation initiation factor eIF-2B subunit 2-like Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9UYB6 8.7e-12 68 28 4 181 3 PYRAB15920 Putative translation initiation factor eIF-2B subunit 2-like Pyrococcus abyssi (strain GE5 / Orsay)
Q99LC8 3.69e-11 67 27 5 205 1 Eif2b1 Translation initiation factor eIF2B subunit alpha Mus musculus
Q0IIF2 6.93e-11 66 28 5 206 2 EIF2B1 Translation initiation factor eIF2B subunit alpha Bos taurus
Q5RAR0 2.1e-10 64 28 5 206 2 EIF2B1 Translation initiation factor eIF2B subunit alpha Pongo abelii
Q14232 2.1e-10 64 28 5 206 1 EIF2B1 Translation initiation factor eIF2B subunit alpha Homo sapiens
Q8U3J1 2.55e-10 63 29 5 181 3 PF0475 Putative translation initiation factor eIF-2B subunit 2-like Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q4R4V8 7.5e-10 63 27 5 206 2 EIF2B1 Translation initiation factor eIF2B subunit alpha Macaca fascicularis
Q64270 1.58e-09 62 27 5 206 2 Eif2b1 Translation initiation factor eIF2B subunit alpha Rattus norvegicus
P14741 1.71e-09 62 29 6 189 1 GCN3 Translation initiation factor eIF2B subunit alpha Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q54FM3 4.5e-09 61 26 9 279 3 eif2b4 Translation initiation factor eIF2B subunit delta Dictyostelium discoideum
Q9USP0 1e-08 59 26 4 178 1 gcn3 Translation initiation factor eIF2B subunit alpha Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9UI10 3.96e-06 52 28 6 185 1 EIF2B4 Translation initiation factor eIF2B subunit delta Homo sapiens
Q3T058 9.92e-06 51 26 5 180 2 EIF2B4 Translation initiation factor eIF2B subunit delta Bos taurus
Q63186 2.04e-05 50 26 5 185 2 Eif2b4 Translation initiation factor eIF2B subunit delta Rattus norvegicus
P41111 2.98e-05 49 28 8 184 2 EIF2B4 Translation initiation factor eIF2B subunit delta Oryctolagus cuniculus
Q61749 5.67e-05 48 26 5 191 1 Eif2b4 Translation initiation factor eIF2B subunit delta Mus musculus
Q09924 0.000244 46 23 9 293 1 tif224 Translation initiation factor eIF2B subunit delta Schizosaccharomyces pombe (strain 972 / ATCC 24843)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS09090
Feature type CDS
Gene mtnA
Product S-methyl-5-thioribose-1-phosphate isomerase
Location 1901263 - 1902372 (strand: 1)
Length 1110 (nucleotides) / 369 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2661
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01008 Initiation factor 2 subunit family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0182 Amino acid transport and metabolism (E) E 5-methylthioribose/5-deoxyribulose 1-phosphate isomerase (methionine salvage pathway), a paralog of eIF-2B alpha subunit

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08963 methylthioribose-1-phosphate isomerase [EC:5.3.1.23] Cysteine and methionine metabolism
Metabolic pathways		 Methionine salvage pathway

Protein Sequence

MKIQGKHYRSVWLAENGVNVCIFDQTKLPFEISILQLATPEEAATSIKDMWVRGAPLIGAVAAYGVALAMHRDSSDAALKTAYDTLVVTRPTAINLKWALDRICTALTPLAPNARCEAAYRIAGEIADEDAEICHRIGEHGLTIIRDIAARKKPGEPVNILTHCNAGWLATVDWGTALSPIYQAYNEGINIHVWVDETRPRNQGGLTAFELGSHGVPHTLIADNAGGHLMQHGEVDMCIVGTDRTTARGDVCNKIGTYLKALAAKANNVPFYVALPSPTLDFTVWDGVKEIPIEQRAGEEQSHVFGITPEGTRSWVNTAPQGTTCGNYAFDVTPAEYVTGLITERGICDATPAGLKAMFPEMWPSEYEV

Flanking regions ( +/- flanking 50bp)

TCACACCATTTCTTTCTTATTGTTAATCGCCACCTGCTTACGAGGCCATAATGAAAATTCAGGGAAAACACTACCGCTCCGTCTGGTTAGCTGAAAACGGCGTAAATGTCTGTATTTTTGATCAGACAAAACTGCCGTTTGAGATCAGTATTCTTCAGTTAGCCACACCGGAAGAGGCTGCGACCTCGATTAAAGATATGTGGGTGCGCGGCGCACCGCTGATTGGTGCGGTTGCCGCTTACGGCGTGGCGCTGGCAATGCATCGTGACAGCAGTGATGCCGCACTGAAAACAGCCTACGATACACTTGTTGTCACCCGCCCGACGGCAATCAACCTGAAATGGGCGCTGGACCGGATCTGCACCGCACTCACACCGCTGGCGCCAAATGCCCGTTGTGAAGCGGCTTACCGCATTGCCGGTGAAATCGCAGATGAGGATGCTGAGATCTGCCACCGTATTGGTGAGCACGGACTGACGATTATCCGTGATATTGCCGCCCGTAAAAAACCGGGAGAGCCTGTCAATATTCTGACGCACTGTAATGCAGGCTGGTTGGCAACCGTAGACTGGGGCACGGCGCTGTCACCCATTTATCAGGCATATAATGAAGGAATTAATATTCACGTCTGGGTGGATGAAACCCGTCCGCGCAACCAGGGCGGACTGACCGCTTTTGAGCTGGGTTCACACGGCGTGCCACATACCCTGATCGCAGATAATGCCGGGGGGCATCTGATGCAGCACGGCGAAGTGGACATGTGTATTGTCGGAACCGACCGCACCACGGCTCGCGGGGATGTCTGTAATAAAATCGGTACCTACCTGAAAGCGCTGGCAGCCAAAGCGAATAATGTGCCGTTTTATGTGGCACTGCCCTCGCCGACTCTCGATTTCACTGTGTGGGATGGCGTAAAAGAGATCCCGATTGAGCAACGCGCCGGTGAAGAGCAATCTCATGTATTCGGTATTACGCCCGAAGGCACGCGCAGTTGGGTGAATACCGCACCGCAAGGGACAACCTGCGGCAACTATGCGTTTGATGTCACACCGGCGGAATATGTCACCGGGCTGATTACCGAGCGCGGTATTTGTGATGCCACACCGGCAGGGCTTAAAGCCATGTTCCCGGAGATGTGGCCGTCAGAGTATGAGGTGTAACCATGACCCGCACAGCGCTGGCACAACAGATTATCGATACCTGCCTGAAA