Homologs in group_2652

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04470 FBDBKF_04470 86.7 Morganella morganii S1 aRO8 DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain
EHELCC_05760 EHELCC_05760 86.7 Morganella morganii S2 aRO8 DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain
NLDBIP_06080 NLDBIP_06080 86.7 Morganella morganii S4 aRO8 DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain
LHKJJB_02960 LHKJJB_02960 86.7 Morganella morganii S3 aRO8 DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain
HKOGLL_06435 HKOGLL_06435 86.7 Morganella morganii S5 aRO8 DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain

Distribution of the homologs in the orthogroup group_2652

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2652

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77730 5.7e-82 264 33 5 469 3 ydcR Uncharacterized HTH-type transcriptional regulator YdcR Escherichia coli (strain K12)
P39389 2.67e-74 244 32 12 477 3 yjiR Uncharacterized HTH-type transcriptional regulator YjiR Escherichia coli (strain K12)
Q5HJR1 4.18e-40 152 26 8 446 3 norG HTH-type transcriptional regulator NorG Staphylococcus aureus (strain COL)
Q2G1P1 4.18e-40 152 26 8 446 1 norG HTH-type transcriptional regulator NorG Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKF1 4.18e-40 152 26 8 446 3 norG HTH-type transcriptional regulator NorG Staphylococcus aureus (strain USA300)
Q796Q6 9.37e-40 152 25 11 486 3 yisV Uncharacterized HTH-type transcriptional regulator YisV Bacillus subtilis (strain 168)
Q2YUS3 1.06e-38 149 26 9 446 3 norG HTH-type transcriptional regulator NorG Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A875 1.26e-38 149 25 8 446 3 norG HTH-type transcriptional regulator NorG Staphylococcus aureus (strain N315)
Q99XA5 1.26e-38 149 25 8 446 3 norG HTH-type transcriptional regulator NorG Staphylococcus aureus (strain Mu50 / ATCC 700699)
P96681 6.81e-37 144 25 13 488 3 ydfD Uncharacterized HTH-type transcriptional regulator YdfD Bacillus subtilis (strain 168)
H3ZPL1 3.16e-32 130 25 6 355 1 OCC_04335 Aromatic-amino-acid aminotransferase 1 Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
Q72LL6 3.04e-31 127 27 6 328 1 lysN 2-aminoadipate transaminase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
P95957 2.8e-25 110 25 5 313 3 SSO0104 Uncharacterized aminotransferase SSO0104 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q08792 4.1e-25 110 25 10 371 3 ycxD Uncharacterized HTH-type transcriptional regulator YcxD Bacillus subtilis (strain 168)
P49309 3.5e-21 99 25 14 442 3 mocR Probable rhizopine catabolism regulatory protein MocR Rhizobium meliloti
D5AKX9 9.28e-19 92 26 12 455 1 tauR HTH-type transcriptional regulator TauR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P94426 1.56e-15 82 23 12 399 1 gabR HTH-type transcriptional regulatory protein GabR Bacillus subtilis (strain 168)
Q9WVM8 8.52e-15 79 25 7 328 1 Aadat Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial Mus musculus
Q56232 8.58e-15 79 27 13 308 1 aspC Aspartate/prephenate aminotransferase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q8N5Z0 5.35e-14 77 26 9 318 1 AADAT Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial Homo sapiens
Q60317 1.02e-13 76 22 6 267 3 MJ0001 Probable aspartate aminotransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P96669 1.7e-13 75 24 20 441 3 ydeL Uncharacterized HTH-type transcriptional regulator YdeL Bacillus subtilis (strain 168)
Q5E9N4 1.82e-13 75 25 11 321 2 AADAT Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial Bos taurus
Q64602 1.99e-13 75 25 11 327 1 Aadat Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial Rattus norvegicus
O07578 5.47e-13 74 25 18 394 3 yhdI Uncharacterized HTH-type transcriptional regulator YhdI Bacillus subtilis (strain 168)
P40193 8.67e-13 73 24 14 435 1 ptsJ Vitamin B6 salvage pathway transcriptional repressor PtsJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O58489 1.06e-12 73 23 8 266 3 aspC Aspartate aminotransferase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q54K00 1.94e-12 72 23 9 321 3 DDB_G0287711 Aromatic amino acid aminotransferase DDB_G0287711 Dictyostelium discoideum
P96663 6.29e-12 71 22 16 413 3 ydeF Uncharacterized HTH-type transcriptional regulator YdeF Bacillus subtilis (strain 168)
Q93703 3.29e-11 68 22 12 327 1 tatn-1 Tyrosine aminotransferase Caenorhabditis elegans
P96847 4.1e-11 68 24 14 355 1 aspB Valine--pyruvate aminotransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q8QZR1 4.14e-11 68 26 7 193 1 Tat Tyrosine aminotransferase Mus musculus
Q8NS92 5.48e-11 68 25 12 362 3 pdxR HTH-type pyridoxine biosynthesis transcriptional regulator PdxR Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P04694 5.65e-11 68 26 7 193 1 Tat Tyrosine aminotransferase Rattus norvegicus
Q58CZ9 3.5e-10 65 26 7 197 2 TAT Tyrosine aminotransferase Bos taurus
Q9FN30 3.98e-10 65 23 16 388 2 At5g53970 Probable aminotransferase TAT2 Arabidopsis thaliana
Q54K95 5.11e-10 65 28 7 205 3 tat Tyrosine aminotransferase Dictyostelium discoideum
O14192 5.28e-10 65 23 12 343 3 SPAC56E4.03 Aromatic amino acid aminotransferase C56E4.03 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q60013 5.95e-10 64 25 14 327 3 aspC Aspartate aminotransferase Streptomyces virginiae
P55683 6.05e-10 64 26 6 227 3 hisC Histidinol-phosphate aminotransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9X0Y2 6.15e-10 64 25 13 322 1 aspC Aspartate aminotransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q98B00 7.15e-10 64 28 4 175 3 hisC3 Histidinol-phosphate aminotransferase 3 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q58097 1.55e-09 63 27 14 302 1 mfnC (5-formylfuran-3-yl)methyl phosphate transaminase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9LVY1 1.62e-09 63 26 10 269 1 TAT Tyrosine aminotransferase Arabidopsis thaliana
O33822 1.7e-09 63 25 13 308 3 aspC Probable aspartate/prephenate aminotransferase Thermus aquaticus
A0A0P0VI36 1.82e-09 63 27 9 188 1 NAAT1 Nicotianamine aminotransferase 1 Oryza sativa subsp. japonica
Q67Y55 2.33e-09 63 26 8 226 2 At4g28420 Probable aminotransferase TAT1 Arabidopsis thaliana
Q8VYP2 3.81e-09 62 24 11 288 2 At4g23590 Probable aminotransferase TAT4 Arabidopsis thaliana
Q08432 4.77e-09 61 24 8 257 1 patB Cystathionine beta-lyase PatB Bacillus subtilis (strain 168)
P17735 7.3e-09 61 26 8 205 1 TAT Tyrosine aminotransferase Homo sapiens
F8P1W6 7.97e-09 61 23 7 269 2 amt1 L-tyrosine:2-oxoglutarate aminotransferase amt1 Serpula lacrymans var. lacrymans (strain S7.9)
Q9SUR6 1.06e-08 60 24 16 351 1 CORI3 Cystine lyase CORI3 Arabidopsis thaliana
O67781 1.29e-08 60 25 13 326 3 aspC Probable aspartate/prephenate aminotransferase Aquifex aeolicus (strain VF5)
Q01856 1.66e-08 60 22 10 450 3 RHOS4_30730 Uncharacterized HTH-type transcriptional regulator RHOS4_30730 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q82DR2 2.36e-08 59 29 9 189 1 aspC1 Aspartate aminotransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q795M6 5.25e-08 58 25 11 256 3 yugH Putative aminotransferase YugH Bacillus subtilis (strain 168)
Q07IG8 7.26e-08 58 24 9 256 3 hisC Histidinol-phosphate aminotransferase Rhodopseudomonas palustris (strain BisA53)
O52815 7.54e-08 58 27 6 187 1 hpgT (S)-3,5-dihydroxyphenylglycine transaminase Amycolatopsis orientalis
Q9Y7S6 8.55e-08 58 24 11 272 3 SPCC569.07 Aromatic amino acid aminotransferase C569.07 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P09053 8.55e-08 58 22 11 307 1 avtA Valine--pyruvate aminotransferase Escherichia coli (strain K12)
Q8GYY0 1.37e-07 57 22 7 275 2 ACS12 Probable aminotransferase ACS12 Arabidopsis thaliana
A7XRY8 2.86e-07 56 23 9 320 1 tdiD Aminotransferase tdiD Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q30ZX9 3.91e-07 55 23 12 334 3 dapL LL-diaminopimelate aminotransferase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
P14909 3.93e-07 55 21 15 305 1 aspC Aspartate aminotransferase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q20YH9 4.19e-07 55 24 9 257 3 hisC Histidinol-phosphate aminotransferase Rhodopseudomonas palustris (strain BisB18)
C6C2Z3 5.27e-07 55 22 13 316 1 Dd703_1457 Aspartate aminotransferase Musicola paradisiaca (strain Ech703)
P10356 7.05e-07 55 25 16 337 1 YER152C Uncharacterized protein YER152C Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
D5FKJ2 8.65e-07 54 28 9 199 3 mrsB L-aspartate:5-guanidino-3-methyl-2-oxopentanoate transaminase Pseudomonas syringae pv. syringae
B3Q8Z5 1.59e-06 53 25 10 256 3 hisC Histidinol-phosphate aminotransferase Rhodopseudomonas palustris (strain TIE-1)
P61002 1.59e-06 53 25 10 256 3 hisC Histidinol-phosphate aminotransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q9SIV0 1.85e-06 53 24 6 191 1 SUR1 S-alkyl-thiohydroximate lyase SUR1 Arabidopsis thaliana
Q2IS68 1.94e-06 53 25 10 254 3 hisC Histidinol-phosphate aminotransferase Rhodopseudomonas palustris (strain HaA2)
P16524 2.11e-06 53 22 10 272 1 dapX Probable N-acetyl-LL-diaminopimelate aminotransferase Bacillus subtilis (strain 168)
E9L7A5 2.4e-06 53 22 18 342 1 PPA-AT Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase Petunia hybrida
Q3M504 3.15e-06 52 29 7 176 3 hisC1 Histidinol-phosphate aminotransferase 1 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B7STY2 5.68e-06 52 23 10 295 1 atrD L-tyrosine:2-oxoglutarate aminotransferase atrD Tapinella panuoides
Q8KDS8 6.01e-06 52 25 15 270 1 CT0966 Aspartate/prephenate aminotransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q9SIE1 6.65e-06 52 20 15 351 1 PAT Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase Arabidopsis thaliana
O93744 1.4e-05 50 21 12 275 3 aspC Aspartate aminotransferase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q9SK47 1.5e-05 50 21 9 278 2 TAT3 Probable aminotransferase TAT3 Arabidopsis thaliana
Q8YV89 2e-05 50 27 9 184 3 hisC1 Histidinol-phosphate aminotransferase 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q4L4E7 2.07e-05 50 27 8 183 3 hisC Histidinol-phosphate aminotransferase Staphylococcus haemolyticus (strain JCSC1435)
B0K625 2.29e-05 50 26 10 201 3 hisC Histidinol-phosphate aminotransferase Thermoanaerobacter sp. (strain X514)
B0K735 2.48e-05 50 26 10 201 3 hisC Histidinol-phosphate aminotransferase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q8DTM1 3.41e-05 49 22 7 267 1 aspB Asparagine--oxo-acid transaminase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q08415 3.52e-05 49 22 10 266 1 Kyat1 Kynurenine--oxoglutarate transaminase 1 Rattus norvegicus
Q9ST02 3.58e-05 49 24 10 207 1 naat-A Nicotianamine aminotransferase A Hordeum vulgare
Q9W698 4e-05 50 23 7 207 3 accs 1-aminocyclopropane-1-carboxylate synthase-like protein 1 Takifugu rubripes
A0M287 4.05e-05 49 28 10 185 3 hisC Histidinol-phosphate aminotransferase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q4J8X2 4.2e-05 49 21 18 341 3 aspC Aspartate aminotransferase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q5F4K8 4.68e-05 49 24 16 327 1 AAT Aspartate aminotransferase Pinus pinaster
Q58874 5.12e-05 49 22 5 200 3 MJ1479 Uncharacterized aminotransferase MJ1479 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q5SHW0 5.54e-05 48 25 15 326 1 TTHA1620 Cystathionine beta-lyase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
B4SGL8 5.75e-05 48 26 5 158 3 hisC Histidinol-phosphate aminotransferase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
B3ECG2 6.57e-05 48 25 4 157 3 hisC Histidinol-phosphate aminotransferase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
O86459 6.99e-05 48 22 14 340 3 aspC Probable aspartate/prephenate aminotransferase Rhizobium leguminosarum bv. phaseoli
Q39K90 0.000104 48 27 12 254 3 hisC1 Histidinol-phosphate aminotransferase 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q9MB95 0.000134 48 20 15 365 2 ACS1 1-aminocyclopropane-1-carboxylate synthase 1 Prunus mume
Q9C969 0.000135 47 20 13 336 1 ISS1 Aromatic aminotransferase ISS1 Arabidopsis thaliana
Q6Q887 0.000151 47 23 5 172 2 sirI Probable aminotransferase sirI Leptosphaeria maculans
Q9ST03 0.000168 47 25 13 232 1 naat-B Nicotianamine aminotransferase B Hordeum vulgare
P0A961 0.000171 47 22 10 275 3 alaA Glutamate-pyruvate aminotransferase AlaA Shigella flexneri
P0A959 0.000171 47 22 10 275 1 alaA Glutamate-pyruvate aminotransferase AlaA Escherichia coli (strain K12)
P0A960 0.000171 47 22 10 275 3 alaA Glutamate-pyruvate aminotransferase AlaA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q131B9 0.000173 47 23 9 259 3 hisC Histidinol-phosphate aminotransferase Rhodopseudomonas palustris (strain BisB5)
Q3Z8H5 0.000208 47 24 16 337 3 dapL LL-diaminopimelate aminotransferase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q8BTY1 0.000224 47 21 14 323 1 Kyat1 Kynurenine--oxoglutarate transaminase 1 Mus musculus
O34712 0.00027 44 40 0 57 2 ytrA HTH-type transcriptional repressor YtrA Bacillus subtilis (strain 168)
Q3SV41 0.000277 46 26 8 193 3 hisC Histidinol-phosphate aminotransferase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A1BGB4 0.000286 46 24 6 179 3 hisC Histidinol-phosphate aminotransferase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q02635 0.000345 46 21 14 351 1 aatA Aspartate/prephenate aminotransferase Rhizobium meliloti (strain 1021)
O31761 0.000432 45 38 0 63 4 ymfC Uncharacterized HTH-type transcriptional regulator YmfC Bacillus subtilis (strain 168)
Q49VS0 0.000442 46 25 7 182 3 hisC Histidinol-phosphate aminotransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8KD01 0.000479 45 24 4 157 3 hisC Histidinol-phosphate aminotransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q3J7H2 0.00052 45 23 10 247 3 hisC2 Histidinol-phosphate aminotransferase 2 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q845V2 0.000583 45 26 8 240 3 hisC Histidinol-phosphate aminotransferase Burkholderia multivorans (strain ATCC 17616 / 249)
Q84CG1 0.000588 45 26 7 178 1 vioD Capreomycidine synthase Streptomyces vinaceus
O34817 0.000603 45 38 0 67 1 nagR HTH-type transcriptional repressor NagR Bacillus subtilis (strain 168)
Q9V0L2 0.000625 45 21 14 305 3 aspC Aspartate aminotransferase Pyrococcus abyssi (strain GE5 / Orsay)
Q3AC10 0.000654 45 24 12 291 3 dapL LL-diaminopimelate aminotransferase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B9LNJ8 0.000677 45 25 6 161 3 hisC Histidinol-phosphate aminotransferase Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34)
Q9KCA8 0.000697 45 22 8 213 3 hisC Histidinol-phosphate aminotransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q57004 0.00077 45 23 8 218 3 hisC2 Histidinol-phosphate aminotransferase 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9SAR0 0.001 45 23 13 261 1 ACS6 1-aminocyclopropane-1-carboxylate synthase 6 Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08920
Feature type CDS
Gene -
Product PLP-dependent aminotransferase family protein
Location 1851311 - 1852753 (strand: 1)
Length 1443 (nucleotides) / 480 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2652
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00155 Aminotransferase class I and II
PF00392 Bacterial regulatory proteins, gntR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1167 Transcription (K)
Amino acid transport and metabolism (E)		 KE DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain

Protein Sequence

MASLPRYRQITEQIKRAVQEGVLPPDTRLPSVRTLATQHNVSLTTALKALRTLEDEHVAVARPKSGFFVAPTLPLSREPVKSETPPADFAQLDEQTELHMSMVGEACRVPLDLANGRRELYPVRKLSQIMRQLSYSKPFLLGDCVKGTGYPPLKEEIARRAVSYGCNITPDTLLITNGCIEALSLALRATLEPGDAVAVESPCYFVLLQMLRNLDLRLTEVDACPEGYVDCDKLTSLFRRKAVKAFVTLANVNNPLGKTIPDEIKADITRQADENGIIIIEDDTFGDAAFGEQRPFPMRAFSRNVILCSGFSKTIAPGVRIGWVHSLHYMRKITSLKYTSSMGSQVLPQAAISELLSNGGYDAHLRRLRRELAVQIQKIRNLVLRTFPPGTTVTTPEGGYVLWVTMPEGSLNVRTLFLNARAEGIGIAPGHIFATDSRYDLCFRLNAGFGCDTEVETAIRQLAQWCRGSLPAQKSPPVAG

Flanking regions ( +/- flanking 50bp)

AGCATACTCTTACTGATACACACAGAACCCTGAAGAATGAGGCAGAACAGATGGCGTCCCTTCCCCGCTACCGGCAGATAACAGAACAGATAAAACGGGCGGTTCAGGAAGGTGTTCTGCCGCCTGATACCCGGCTGCCGTCTGTCAGAACACTGGCAACGCAACACAATGTCAGCCTGACCACCGCTCTGAAAGCCCTGCGCACACTGGAGGATGAACATGTCGCGGTTGCCAGGCCGAAGTCCGGTTTTTTTGTCGCGCCAACTCTGCCTCTGTCACGCGAACCGGTAAAATCAGAAACGCCGCCTGCTGACTTTGCACAGCTGGATGAACAGACAGAACTGCATATGTCGATGGTCGGTGAAGCCTGCCGTGTCCCGCTGGATCTGGCGAACGGCAGGCGGGAGCTGTATCCGGTGAGAAAATTGAGCCAGATTATGCGCCAGCTCAGCTACAGCAAGCCCTTTCTGCTGGGTGATTGTGTAAAAGGAACCGGTTACCCGCCGCTGAAAGAGGAAATCGCCCGGCGGGCGGTCAGTTACGGCTGCAACATTACCCCTGACACTCTGCTTATCACCAACGGCTGTATTGAGGCGCTCTCCCTCGCACTGCGCGCAACCCTTGAGCCCGGTGATGCTGTTGCCGTGGAGTCTCCCTGCTATTTCGTCCTGTTACAGATGCTGCGCAATCTTGATCTCCGGCTGACCGAAGTGGACGCCTGCCCCGAAGGATATGTGGATTGCGACAAACTCACATCCCTCTTCCGCCGCAAAGCCGTAAAAGCATTTGTCACCCTGGCAAATGTGAATAATCCGCTGGGTAAAACGATCCCTGATGAAATCAAAGCGGACATCACCCGACAGGCAGATGAAAACGGGATTATCATCATTGAGGATGATACTTTCGGTGATGCGGCATTTGGTGAGCAGCGCCCGTTTCCGATGCGGGCATTCAGCCGCAATGTGATCCTATGCAGCGGATTTTCCAAAACCATCGCACCCGGCGTGCGGATAGGCTGGGTTCACAGCCTGCACTACATGCGGAAAATCACCTCGCTGAAATACACCTCATCAATGGGCTCTCAGGTTCTGCCGCAGGCCGCCATCAGCGAGTTGCTGAGCAACGGCGGCTATGATGCACATCTGCGCCGCCTGCGCCGGGAACTGGCAGTACAGATACAAAAAATCCGCAACCTTGTGCTGCGGACGTTTCCACCGGGCACGACGGTAACAACGCCGGAAGGCGGTTATGTTCTGTGGGTGACAATGCCGGAAGGCAGCCTGAATGTCCGGACACTGTTTCTCAACGCGCGGGCTGAAGGGATAGGCATTGCACCCGGTCATATTTTTGCGACGGACAGCCGCTACGACCTCTGTTTCCGGCTAAATGCGGGGTTCGGCTGTGATACTGAAGTGGAAACCGCCATCAGGCAACTGGCGCAATGGTGCCGGGGATCGTTACCGGCACAGAAAAGCCCGCCGGTGGCGGGCTGACAGTAAATACGACATAGAAATTACTGCAAATCACTGTCCGTATACAATCT