Homologs in group_1687

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10920 FBDBKF_10920 90.6 Morganella morganii S1 ygiN Quinol monooxygenase YgiN
EHELCC_05305 EHELCC_05305 90.6 Morganella morganii S2 ygiN Quinol monooxygenase YgiN
NLDBIP_05625 NLDBIP_05625 90.6 Morganella morganii S4 ygiN Quinol monooxygenase YgiN
LHKJJB_02505 LHKJJB_02505 90.6 Morganella morganii S3 ygiN Quinol monooxygenase YgiN
HKOGLL_15885 HKOGLL_15885 90.6 Morganella morganii S5 ygiN Quinol monooxygenase YgiN
PMI_RS06570 PMI_RS06570 55.2 Proteus mirabilis HI4320 - putative quinol monooxygenase

Distribution of the homologs in the orthogroup group_1687

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1687

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P73602 5.57e-09 53 33 0 66 3 sll1783 Uncharacterized protein sll1783 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P94425 8.93e-07 46 32 0 67 1 ycnE Putative monooxygenase YcnE Bacillus subtilis (strain 168)
O86332 3.27e-06 45 35 1 70 1 Rv0793 Putative monooxygenase Rv0793 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08415
Feature type CDS
Gene -
Product putative quinol monooxygenase
Location 1739302 - 1739592 (strand: 1)
Length 291 (nucleotides) / 96 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1687
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03992 Antibiotic biosynthesis monooxygenase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1359 Energy production and conversion (C) C Quinol monooxygenase YgiN

Protein Sequence

MLKVIAEDFMQPDAVEILMPMYEELVAATRKEPLCISYDLFVDRRDPGHFVFIETWPDQAALDIHCASEHFQRLVPAINKYQRDEPRFILMNNAVE

Flanking regions ( +/- flanking 50bp)

TTCAGTTGCAGATATTTCATGACTACCCGTGCACAAACAAGGAGTAAGGAATGTTAAAAGTGATCGCTGAAGATTTCATGCAACCGGATGCCGTTGAAATCCTGATGCCGATGTATGAGGAATTAGTCGCTGCCACCCGCAAAGAGCCGCTGTGTATCAGTTACGATCTGTTTGTGGACCGCCGGGATCCGGGACATTTTGTGTTTATTGAAACCTGGCCTGATCAGGCGGCACTGGATATCCATTGTGCCAGCGAACATTTTCAGCGCCTGGTGCCGGCTATCAATAAATATCAGCGGGATGAGCCACGCTTTATTCTGATGAACAACGCGGTTGAATAAAACCGGCGGGGCAGAATAACCGCCCCGTATTCTCTTTATTCTTGTCGCTA