Homologs in group_4087
0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product |
|---|
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| Q9I315 | 2.54e-07 | 48 | 48 | 0 | 39 | 1 | pscI | Type III inner-rod protein PscI | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Source | Morganella psychrotolerans |
|---|---|
| Locus tag | F4V73_RS08390 |
| Feature type | CDS |
| Gene | sctI |
| Product | type III secretion system inner rod subunit SctI |
| Location | 1736103 - 1736417 (strand: 1) |
| Length | 315 (nucleotides) / 104 (amino acids) |
| Accession | term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object |
|---|---|
| Length | 2012992 nucleotides |
| Topology | linear |
| Plasmid | False |
| Orthogroup | group_4087 | |
|---|---|---|
| Orthogroup size | 1 | |
| N. genomes | 1 |
| PF17001 | Type III secretion basal body protein I, YscI, HrpB, PscI |
|---|
MISAPRTHTLSLTDLSVSPEDNTLSAIPQAEETRSLKKLFDGFYQSIKQDTDKIASLRNSDALTSPDALLQTQLALAKIHFREELLAKTVGKVSQNIDMMIKSQ
TCAGTCAATAATCAACTGGCCTTCTGCCAATATAATCTCCGGTAATGATAATGATCTCTGCTCCCCGCACACATACACTTTCACTGACGGATCTGTCTGTATCGCCGGAAGATAATACGCTTTCAGCGATACCACAGGCCGAGGAAACACGCTCACTGAAGAAACTGTTTGATGGTTTTTATCAGTCAATCAAACAGGATACAGACAAGATAGCATCATTACGCAATAGTGACGCACTTACATCTCCGGATGCATTACTACAGACTCAGTTGGCTCTGGCAAAAATTCATTTCCGTGAGGAATTACTGGCTAAAACAGTCGGGAAGGTGAGTCAGAATATCGATATGATGATAAAAAGCCAGTAATATGCAGATCCCTACTCCTTTTTATCGCCCTGTATTCCGCTGTATAACGC
