Homologs in group_2881

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11535 FBDBKF_11535 86.5 Morganella morganii S1 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase MenH and related esterases, alpha/beta hydrolase fold
EHELCC_17455 EHELCC_17455 86.5 Morganella morganii S2 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase MenH and related esterases, alpha/beta hydrolase fold
NLDBIP_18665 NLDBIP_18665 86.5 Morganella morganii S4 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase MenH and related esterases, alpha/beta hydrolase fold
LHKJJB_17895 LHKJJB_17895 86.5 Morganella morganii S3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase MenH and related esterases, alpha/beta hydrolase fold
HKOGLL_18755 HKOGLL_18755 86.5 Morganella morganii S5 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase MenH and related esterases, alpha/beta hydrolase fold

Distribution of the homologs in the orthogroup group_2881

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2881

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O52866 8.75e-40 144 32 5 282 1 None Soluble epoxide hydrolase Corynebacterium sp. (strain C12)
Q6NAM1 2.76e-24 103 30 9 293 1 RPA1163 Fluoroacetate dehalogenase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
G5EBI4 4.88e-20 93 26 11 295 1 ceeh-1 Epoxide hydrolase 1 Caenorhabditis elegans
Q8IUS5 1.77e-19 91 25 11 297 1 EPHX4 Epoxide hydrolase 4 Homo sapiens
Q6IE26 1.71e-18 88 25 11 297 2 Ephx4 Epoxide hydrolase 4 Mus musculus
P34913 2.05e-17 86 23 10 314 1 EPHX2 Bifunctional epoxide hydrolase 2 Homo sapiens
Q6Q2C2 1.5e-16 83 22 6 299 2 EPHX2 Bifunctional epoxide hydrolase 2 Sus scrofa
Q9H6B9 3.35e-16 81 25 13 288 1 EPHX3 Epoxide hydrolase 3 Homo sapiens
P34914 2.42e-15 80 22 9 346 1 Ephx2 Bifunctional epoxide hydrolase 2 Mus musculus
Q3V1F8 2.63e-15 79 24 11 284 2 Ephx3 Epoxide hydrolase 3 Mus musculus
P80299 4.02e-15 79 22 9 346 1 Ephx2 Bifunctional epoxide hydrolase 2 Rattus norvegicus
Q01398 4.44e-14 74 23 10 295 1 dehH1 Haloacetate dehalogenase H-1 Moraxella sp. (strain B)
I6YGS0 3.66e-12 69 27 13 316 1 ephA Epoxide hydrolase A Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
O31581 5.21e-12 68 23 8 289 3 yfhM AB hydrolase superfamily protein YfhM Bacillus subtilis (strain 168)
Q1JU72 5.56e-12 68 29 4 158 1 fac-dex Fluoroacetate dehalogenase Burkholderia sp.
P0A3G3 2.05e-11 67 34 2 126 1 dhaA Haloalkane dehalogenase Rhodococcus sp.
P0A3G2 2.05e-11 67 34 2 126 1 dhaA Haloalkane dehalogenase Rhodococcus rhodochrous
P0A3G4 2.05e-11 67 34 2 126 1 dhaA Haloalkane dehalogenase Pseudomonas pavonaceae
P59336 2.15e-11 67 34 2 126 1 dhaA Haloalkane dehalogenase Rhodococcus sp. (strain TDTM0003)
Q9ZER0 2.36e-11 67 34 2 126 2 dhaAF Haloalkane dehalogenase Mycobacterium sp. (strain GP1)
G5EDL5 2.76e-11 67 21 12 307 1 ceeh-2 Epoxide hydrolase 2 Caenorhabditis elegans
Q0IIS3 3.94e-11 66 28 8 177 2 ephx3 Epoxide hydrolase 3 Xenopus tropicalis
P0DO69 4.92e-11 66 31 3 154 1 EPH2 Epoxide hydrolase 2 Siraitia grosvenorii
P0DO70 8.95e-11 65 32 2 134 1 EPH3 Epoxide hydrolase 3 Siraitia grosvenorii
Q8EG65 4.12e-10 63 29 5 137 1 oleB Cis-3-alkyl-4-alkyloxetan-2-one decarboxylase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q55921 4.82e-10 62 25 8 275 3 slr0314 Putative non-heme chloroperoxidase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P29715 9.64e-09 58 32 1 115 1 bpoA2 Non-haem bromoperoxidase BPO-A2 Kitasatospora aureofaciens
O31168 1.12e-08 58 32 1 115 1 cpo Non-heme chloroperoxidase Kitasatospora aureofaciens
I6YC03 3.8e-08 57 31 2 114 1 ephB Epoxide hydrolase B Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P95276 3.8e-08 57 31 2 114 1 MT1988 Epoxide hydrolase B Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0DO68 6.19e-08 57 21 9 321 1 EPH1 Epoxide hydrolase 1 Siraitia grosvenorii
Q1QBB9 8.04e-08 56 27 3 140 1 dhmA Haloalkane dehalogenase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
O31158 1.28e-07 55 39 0 76 1 cpo Non-heme chloroperoxidase Pseudomonas fluorescens
P22862 1.5e-07 55 30 1 123 1 estF Arylesterase Pseudomonas fluorescens
O06734 1.56e-07 55 29 1 113 3 yisY AB hydrolase superfamily protein YisY Bacillus subtilis (strain 168)
Q9AQM4 1.76e-07 55 23 10 296 1 carC 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid hydrolase Pseudomonas resinovorans
P27747 2.76e-07 55 33 2 121 1 acoC Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P0A573 2.77e-07 55 30 1 118 3 BQ2027_MB2734 Uncharacterized protein Mb2734 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WNH3 2.77e-07 55 30 1 118 1 Rv2715 Uncharacterized protein Rv2715 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNH2 2.77e-07 55 30 1 118 3 MT2788 Uncharacterized protein MT2788 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WMS1 3.65e-07 54 29 2 119 1 dhmA2 Haloalkane dehalogenase 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMS0 3.65e-07 54 29 2 119 3 dhmA2 Haloalkane dehalogenase 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64304 3.65e-07 54 29 2 119 3 dhmA2 Haloalkane dehalogenase 2 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q02104 6.75e-07 53 24 7 225 1 lip1 Lipase 1 Psychrobacter immobilis
Q8U671 1.6e-06 52 27 2 128 1 dhaA Haloalkane dehalogenase Agrobacterium fabrum (strain C58 / ATCC 33970)
P9WMR9 1.93e-06 52 25 14 310 1 dhaA Haloalkane dehalogenase 3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMR8 1.93e-06 52 25 14 310 3 dhaA Haloalkane dehalogenase 3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U5S9 1.93e-06 52 25 14 310 3 dhaA Haloalkane dehalogenase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q9XB14 2.48e-06 52 25 14 310 3 dhaA Haloalkane dehalogenase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
C1AF48 2.9e-06 51 25 14 310 3 dhaA Haloalkane dehalogenase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KLS7 2.9e-06 51 25 14 310 3 dhaA Haloalkane dehalogenase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
B2JQW2 8.26e-06 50 24 13 285 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B8H3S9 8.78e-06 50 24 8 292 3 dhmA Haloalkane dehalogenase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A919 8.78e-06 50 24 8 292 1 dhmA Haloalkane dehalogenase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
D3H122 1.93e-05 48 37 2 91 3 rutD Putative carbamate hydrolase RutD Escherichia coli O44:H18 (strain 042 / EAEC)
B0SY51 2.47e-05 48 29 3 133 3 dhmA Haloalkane dehalogenase Caulobacter sp. (strain K31)
C5CN82 3.75e-05 48 32 2 112 3 rutD Putative carbamate hydrolase RutD Variovorax paradoxus (strain S110)
Q7SHI0 5.65e-05 47 22 12 327 2 srdG Epoxide hydrolase srdG Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P49323 6.22e-05 47 25 9 240 1 cpo Non-heme chloroperoxidase Streptomyces lividans
B2HJU9 8.07e-05 47 27 3 133 3 dhmA Haloalkane dehalogenase Mycobacterium marinum (strain ATCC BAA-535 / M)
P33912 9.58e-05 47 33 0 89 1 bpoA1 Non-heme chloroperoxidase CPO-A1 Kitasatospora aureofaciens
A0A1L5BTC1 9.64e-05 47 29 4 127 3 linB Haloalkane dehalogenase Sphingobium indicum (strain DSM 16412 / CCM 7286 / MTCC 6364 / B90A)
P9WNH5 9.89e-05 47 34 5 119 1 hsaD 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNH4 9.89e-05 47 34 5 119 3 hsaD 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P53750 0.000107 47 29 4 111 3 YNR064C Uncharacterized hydrolase YNR064C Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q988D4 0.00011 46 23 10 286 1 mlr6787 2-(acetamidomethylene)succinate hydrolase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B7N3G5 0.000112 46 34 3 96 3 rutD Putative carbamate hydrolase RutD Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
D4Z2G1 0.000117 46 29 4 126 1 linB Haloalkane dehalogenase Sphingobium indicum (strain DSM 16413 / CCM 7287 / MTCC 6362 / UT26 / NBRC 101211 / UT26S)
Q1RDK8 0.000119 46 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli (strain UTI89 / UPEC)
B1LIZ6 0.000121 46 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli (strain SMS-3-5 / SECEC)
D5CZG9 0.000122 46 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli O18:K1:H7 (strain IHE3034 / ExPEC)
A1A9R4 0.000122 46 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli O1:K1 / APEC
B7MIF6 0.000122 46 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0TJ58 0.000132 46 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q83LK8 0.000137 46 34 3 96 3 rutD Putative carbamate hydrolase RutD Shigella flexneri
D2AC40 0.000137 46 34 3 96 3 rutD Putative carbamate hydrolase RutD Shigella flexneri serotype X (strain 2002017)
Q0T625 0.000138 46 34 3 96 3 rutD Putative carbamate hydrolase RutD Shigella flexneri serotype 5b (strain 8401)
B7NLB7 0.000151 46 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q8FJ43 0.000184 46 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
D2NGI6 0.000204 45 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli O150:H5 (strain SE15)
B7UNZ2 0.000204 45 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1IV88 0.000226 45 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZYW4 0.000226 45 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli O9:H4 (strain HS)
B7MTF2 0.00025 45 34 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli O81 (strain ED1a)
A7ZKB4 0.000254 45 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli O139:H28 (strain E24377A / ETEC)
C8U5H1 0.000254 45 35 3 93 2 rutD Putative carbamate hydrolase RutD Escherichia coli O103:H2 (strain 12009 / EHEC)
Q52532 0.000412 45 22 12 282 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Pseudomonas sp.
Q32HQ2 0.000424 44 35 3 93 3 rutD Putative carbamate hydrolase RutD Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z3A4 0.000439 44 35 3 93 3 rutD Putative carbamate hydrolase RutD Shigella sonnei (strain Ss046)
B7LFB9 0.000439 44 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli (strain 55989 / EAEC)
Q07646 0.000449 45 27 4 127 2 Mest Mesoderm-specific transcript protein Mus musculus
C8TNB9 0.000489 44 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli O26:H11 (strain 11368 / EHEC)
C8UMM5 0.000498 44 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli O111:H- (strain 11128 / EHEC)
B7M8Z4 0.000517 44 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli O8 (strain IAI1)
Q6P5P5 0.000518 45 27 4 127 2 Mest Mesoderm-specific transcript homolog protein Rattus norvegicus
O05691 0.000535 44 30 2 130 3 thcF Non-heme haloperoxidase Rhodococcus erythropolis
B6I985 0.000536 44 35 3 93 1 rutD Putative carbamate hydrolase RutD Escherichia coli (strain SE11)
P75895 0.000536 44 35 3 93 1 rutD Putative carbamate hydrolase RutD Escherichia coli (strain K12)
B1X9D0 0.000536 44 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli (strain K12 / DH10B)
C9QZ67 0.000536 44 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli (strain ATCC 33849 / DSM 4235 / NCIMB 12045 / K12 / DH1)
C4ZQD7 0.000536 44 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli (strain K12 / MC4100 / BW2952)
C6UFC0 0.000536 44 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli (strain B / REL606)
C6EHJ8 0.000536 44 35 3 93 3 rutD Putative carbamate hydrolase RutD Escherichia coli (strain B / BL21-DE3)
A6T799 0.000576 44 31 2 85 3 rutD Putative carbamate hydrolase RutD Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B4RF90 0.00058 44 23 7 283 3 dhmA Haloalkane dehalogenase Phenylobacterium zucineum (strain HLK1)
Q8PDW8 0.000639 44 26 4 130 1 oleB Cis-3-alkyl-4-alkyloxetan-2-one decarboxylase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q5EB52 0.000879 44 27 4 127 1 MEST Mesoderm-specific transcript homolog protein Homo sapiens
P9WMS3 0.001 43 28 5 142 1 dhmA1 Haloalkane dehalogenase 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMS2 0.001 43 28 5 142 3 dhmA1 Haloalkane dehalogenase 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64302 0.001 43 28 5 142 3 dhmA1 Haloalkane dehalogenase 1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B5XXN3 0.001 43 31 2 85 3 rutD Putative carbamate hydrolase RutD Klebsiella pneumoniae (strain 342)
D3RKL3 0.001 43 31 2 85 3 rutD Putative carbamate hydrolase RutD Klebsiella variicola (strain At-22)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08125
Feature type CDS
Gene -
Product alpha/beta hydrolase
Location 1686407 - 1687378 (strand: -1)
Length 972 (nucleotides) / 323 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2881
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00561 alpha/beta hydrolase fold

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0596 Coenzyme transport and metabolism (H)
General function prediction only (R)		 HR 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold

Protein Sequence

MNTLFGKVLLATAMTFALYGTASAESVKNPDVASGAVSAQFNEADFQHHYADVAGQRIHYVTAGKGEPVLLIPGWPQTWYAWRYVMAGLAAQGYMAIAVDPPGTGYSARPESGYDTGAVATTLHTMMKQLGHTKYSVVGHDIGMWVGYALAADYPADIKKIALTEAVIPGLAPAPSIFVEPEDNIFLWHFMFNQVQDLPEMLTAGKEQEYLNFIFDHWSYRRDRVAAQTYIDAYSSPGGLRAGFAYYRAIPQTISQNKRRAEKKLTMPVLAIGADHATRDAPLQTLQGRAVNLQGVMLSECGHFVTEECPEQLMAALLPFLNK

Flanking regions ( +/- flanking 50bp)

AGCCAACGAACCTGCAGTTTGAATGAATAAGGGTATACAACGGAACAACTATGAATACATTATTTGGTAAGGTATTACTGGCGACAGCCATGACGTTCGCACTGTACGGCACCGCATCAGCGGAAAGTGTAAAAAATCCGGATGTGGCATCCGGCGCCGTGTCTGCTCAGTTTAATGAGGCTGATTTTCAGCATCACTATGCCGACGTTGCAGGTCAGCGGATCCATTATGTGACGGCGGGCAAAGGTGAGCCGGTTTTACTTATTCCGGGCTGGCCGCAAACCTGGTATGCATGGCGCTATGTTATGGCGGGACTCGCGGCACAAGGGTATATGGCGATAGCTGTTGATCCGCCGGGAACCGGTTATTCTGCCCGTCCGGAGAGTGGTTATGATACCGGTGCGGTGGCAACCACGTTGCATACTATGATGAAGCAACTGGGTCACACTAAATATTCGGTTGTCGGTCATGATATCGGTATGTGGGTGGGCTACGCACTGGCTGCTGATTATCCTGCGGATATTAAAAAAATAGCATTAACGGAAGCGGTAATACCGGGTTTGGCACCGGCACCGTCCATCTTTGTTGAGCCGGAAGACAATATTTTTCTCTGGCACTTTATGTTTAATCAGGTGCAGGATTTACCTGAAATGCTGACTGCCGGAAAAGAGCAGGAATATCTGAATTTTATTTTTGATCACTGGTCTTACCGTCGTGACCGGGTCGCGGCACAAACCTATATAGATGCCTACTCATCACCGGGCGGGTTGCGGGCTGGATTTGCCTATTATCGTGCTATCCCGCAAACTATCAGTCAGAATAAACGGCGCGCAGAGAAAAAACTGACTATGCCGGTTCTGGCAATTGGCGCAGATCACGCTACCCGTGATGCACCGTTGCAGACGTTGCAGGGCAGGGCGGTGAATTTACAGGGTGTGATGCTCAGTGAATGCGGTCACTTTGTTACTGAAGAGTGTCCGGAACAGCTTATGGCGGCTTTGTTGCCATTTCTGAATAAATAGATGTACCGGTTGCCCGTGAATATGTATTTGTGTGCACTGCCGGGACAGGG