Homologs in group_519

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01100 FBDBKF_01100 92.3 Morganella morganii S1 pepB aminopeptidase PepB
EHELCC_00445 EHELCC_00445 92.3 Morganella morganii S2 pepB aminopeptidase PepB
NLDBIP_03015 NLDBIP_03015 92.3 Morganella morganii S4 pepB aminopeptidase PepB
LHKJJB_04530 LHKJJB_04530 92.3 Morganella morganii S3 pepB aminopeptidase PepB
HKOGLL_02515 HKOGLL_02515 92.3 Morganella morganii S5 pepB aminopeptidase PepB
PMI_RS09145 PMI_RS09145 73.7 Proteus mirabilis HI4320 pepB aminopeptidase PepB

Distribution of the homologs in the orthogroup group_519

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_519

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N231 0.0 680 75 1 430 3 pepB Peptidase B Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GHX6 0.0 612 70 1 430 3 pepB Peptidase B Serratia proteamaculans (strain 568)
A8AD60 0.0 610 69 1 421 3 pepB Peptidase B Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5RD05 0.0 607 69 1 421 3 pepB Peptidase B Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R595 0.0 607 69 1 421 3 pepB Peptidase B Salmonella enteritidis PT4 (strain P125109)
B5FR78 0.0 607 69 1 421 3 pepB Peptidase B Salmonella dublin (strain CT_02021853)
Q6D266 0.0 607 67 2 435 3 pepB Peptidase B Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9RF52 0.0 606 69 1 421 1 pepB Peptidase B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
C0PYL4 0.0 606 69 1 421 3 pepB Peptidase B Salmonella paratyphi C (strain RKS4594)
A9N1Y3 0.0 606 69 1 421 3 pepB Peptidase B Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T0R5 0.0 606 69 1 421 3 pepB Peptidase B Salmonella newport (strain SL254)
A9MHK1 0.0 606 69 1 421 3 pepB Peptidase B Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F1B3 0.0 606 69 1 421 3 pepB Peptidase B Salmonella agona (strain SL483)
Q8Z4N3 0.0 606 69 1 421 3 pepB Peptidase B Salmonella typhi
Q57LH5 0.0 605 69 1 421 3 pepB Peptidase B Salmonella choleraesuis (strain SC-B67)
A6TCE4 0.0 600 69 1 421 3 pepB Peptidase B Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Z0Z6 0.0 600 69 1 421 3 pepB Peptidase B Escherichia coli O157:H7 (strain EC4115 / EHEC)
P58473 0.0 600 69 1 421 3 pepB Peptidase B Escherichia coli O157:H7
A7ZPW6 0.0 599 69 1 421 3 pepB Peptidase B Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3YZ29 0.0 599 69 1 421 3 pepB Peptidase B Shigella sonnei (strain Ss046)
B6I595 0.0 599 69 1 421 3 pepB Peptidase B Escherichia coli (strain SE11)
B7M7M6 0.0 599 69 1 421 3 pepB Peptidase B Escherichia coli O8 (strain IAI1)
B7LDB5 0.0 599 69 1 421 3 pepB Peptidase B Escherichia coli (strain 55989 / EAEC)
B1IWD8 0.0 598 69 1 421 3 pepB Peptidase B Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A329 0.0 598 69 1 421 3 pepB Peptidase B Escherichia coli O9:H4 (strain HS)
Q1R8K9 0.0 598 69 1 421 3 pepB Peptidase B Escherichia coli (strain UTI89 / UPEC)
B7N6B0 0.0 598 68 1 421 3 pepB Peptidase B Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A1AE61 0.0 598 69 1 421 3 pepB Peptidase B Escherichia coli O1:K1 / APEC
B7MI07 0.0 598 69 1 421 3 pepB Peptidase B Escherichia coli O45:K1 (strain S88 / ExPEC)
A7FFX8 0.0 598 70 1 430 3 pepB Peptidase B Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q0T1Z6 0.0 598 68 1 421 3 pepB Peptidase B Shigella flexneri serotype 5b (strain 8401)
Q32D41 0.0 598 68 1 421 3 pepB Peptidase B Shigella dysenteriae serotype 1 (strain Sd197)
B1JRZ6 0.0 597 70 1 430 3 pepB Peptidase B Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TMU7 0.0 597 70 1 430 3 pepB Peptidase B Yersinia pestis (strain Pestoides F)
Q1CKA2 0.0 597 70 1 430 3 pepB Peptidase B Yersinia pestis bv. Antiqua (strain Nepal516)
A9R811 0.0 597 70 1 430 3 pepB Peptidase B Yersinia pestis bv. Antiqua (strain Angola)
P58475 0.0 597 70 1 430 1 pepB Peptidase B Yersinia pestis
Q1C5H7 0.0 597 70 1 430 3 pepB Peptidase B Yersinia pestis bv. Antiqua (strain Antiqua)
Q83QK5 0.0 597 68 1 421 3 pepB Peptidase B Shigella flexneri
Q8FF47 0.0 597 69 1 421 3 pepB Peptidase B Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEW2 0.0 597 69 1 421 3 pepB Peptidase B Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MYF7 0.0 597 69 1 421 3 pepB Peptidase B Escherichia coli O81 (strain ED1a)
B7UGW9 0.0 597 69 1 421 3 pepB Peptidase B Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q667Y8 0.0 597 70 1 430 3 pepB Peptidase B Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K9R0 0.0 597 70 1 430 3 pepB Peptidase B Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q31XW7 0.0 597 68 1 421 3 pepB Peptidase B Shigella boydii serotype 4 (strain Sb227)
B2TXU8 0.0 597 68 1 421 3 pepB Peptidase B Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5XNK4 0.0 596 68 1 421 3 pepB Peptidase B Klebsiella pneumoniae (strain 342)
B7LKB6 0.0 596 68 1 421 3 pepB Peptidase B Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LNH8 0.0 596 68 1 421 3 pepB Peptidase B Escherichia coli (strain SMS-3-5 / SECEC)
P37095 0.0 596 68 1 421 1 pepB Peptidase B Escherichia coli (strain K12)
B1XAZ8 0.0 596 68 1 421 3 pepB Peptidase B Escherichia coli (strain K12 / DH10B)
C4ZX98 0.0 596 68 1 421 3 pepB Peptidase B Escherichia coli (strain K12 / MC4100 / BW2952)
A7MGW9 0.0 594 68 1 421 3 pepB Peptidase B Cronobacter sakazakii (strain ATCC BAA-894)
C6DBI4 0.0 590 67 2 435 3 pepB Peptidase B Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B7NRH2 0.0 588 68 1 421 3 pepB Peptidase B Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A4WDA4 0.0 587 67 1 421 3 pepB Peptidase B Enterobacter sp. (strain 638)
A7MU37 0.0 523 60 2 428 3 pepB Peptidase B Vibrio campbellii (strain ATCC BAA-1116)
Q9KTX5 0.0 520 59 1 425 3 pepB Peptidase B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B7VJT3 0.0 516 60 2 426 3 pepB Peptidase B Vibrio atlanticus (strain LGP32)
Q87S21 0.0 516 60 2 428 3 pepB Peptidase B Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MNF5 8.4e-177 503 58 2 428 3 pepB Peptidase B Vibrio vulnificus (strain YJ016)
Q8DEZ4 8.4e-177 503 58 2 428 3 pepB Peptidase B Vibrio vulnificus (strain CMCP6)
Q4QM33 1.89e-176 503 58 3 434 3 pepB Peptidase B Haemophilus influenzae (strain 86-028NP)
P58474 4.44e-176 502 58 3 434 5 pepB Putative peptidase B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CM16 1.06e-174 498 58 2 428 3 pepB Peptidase B Pasteurella multocida (strain Pm70)
Q3A831 2.16e-64 218 41 8 323 3 pepA Probable cytosol aminopeptidase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q5X1Q9 2.87e-64 217 40 9 343 3 pepA Probable cytosol aminopeptidase Legionella pneumophila (strain Paris)
A5IAU5 3.26e-64 217 40 9 343 3 pepA Probable cytosol aminopeptidase Legionella pneumophila (strain Corby)
Q5WTG8 2.11e-63 214 39 9 343 3 pepA Probable cytosol aminopeptidase Legionella pneumophila (strain Lens)
B7HUR5 1.28e-61 210 40 10 325 3 pepA Probable cytosol aminopeptidase Bacillus cereus (strain AH187)
C1DPG2 6.71e-61 208 39 9 371 3 pepA Probable cytosol aminopeptidase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B9J3C5 8.44e-61 208 40 10 325 3 pepA Probable cytosol aminopeptidase Bacillus cereus (strain Q1)
A7GUC8 8.88e-61 208 40 10 325 3 pepA Probable cytosol aminopeptidase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q632E1 9.57e-61 208 40 10 325 3 pepA Probable cytosol aminopeptidase Bacillus cereus (strain ZK / E33L)
Q72YG1 1.09e-60 207 40 10 325 3 pepA Probable cytosol aminopeptidase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6AFG2 1.33e-60 207 42 8 330 3 pepA Probable cytosol aminopeptidase Leifsonia xyli subsp. xyli (strain CTCB07)
A8FH04 1.75e-60 207 38 12 359 3 pepA Probable cytosol aminopeptidase Bacillus pumilus (strain SAFR-032)
B7JDH9 2.41e-60 207 40 10 325 3 pepA Probable cytosol aminopeptidase Bacillus cereus (strain AH820)
Q81XS5 2.41e-60 207 40 10 325 3 pepA Probable cytosol aminopeptidase Bacillus anthracis
C3LC57 2.41e-60 207 40 10 325 3 pepA Probable cytosol aminopeptidase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PDF7 2.41e-60 207 40 10 325 3 pepA Probable cytosol aminopeptidase Bacillus anthracis (strain A0248)
C1EX85 2.54e-60 207 40 10 325 3 pepA Probable cytosol aminopeptidase Bacillus cereus (strain 03BB102)
A0RKB5 2.54e-60 207 40 10 325 3 pepA Probable cytosol aminopeptidase Bacillus thuringiensis (strain Al Hakam)
Q0SQ50 2.73e-60 207 40 6 315 3 pepA Probable cytosol aminopeptidase Clostridium perfringens (strain SM101 / Type A)
Q6HBY2 3.11e-60 206 40 10 325 3 pepA Probable cytosol aminopeptidase Bacillus thuringiensis subsp. konkukian (strain 97-27)
A9VMY8 7.35e-60 206 39 10 325 3 pepA Probable cytosol aminopeptidase Bacillus mycoides (strain KBAB4)
Q8XHI3 1.02e-59 205 40 6 315 3 pepA Probable cytosol aminopeptidase Clostridium perfringens (strain 13 / Type A)
B7IMU0 1.24e-59 205 40 10 325 3 pepA Probable cytosol aminopeptidase Bacillus cereus (strain G9842)
B7HBG1 1.55e-59 205 40 10 325 3 pepA Probable cytosol aminopeptidase Bacillus cereus (strain B4264)
B4F2N1 3.72e-59 204 39 9 344 3 pepA Probable cytosol aminopeptidase Proteus mirabilis (strain HI4320)
B3ED46 5.9e-59 203 42 8 321 3 pepA Probable cytosol aminopeptidase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q816E3 7.01e-59 203 39 10 325 3 pepA Probable cytosol aminopeptidase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A8ML24 8.24e-59 203 39 7 317 3 pepA Probable cytosol aminopeptidase Alkaliphilus oremlandii (strain OhILAs)
Q7UJ62 1.1e-58 203 40 8 318 3 pepA Probable cytosol aminopeptidase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A7NG41 1.27e-58 202 40 6 317 3 pepA Probable cytosol aminopeptidase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
C5D720 2.61e-58 201 39 11 343 3 pepA Probable cytosol aminopeptidase Geobacillus sp. (strain WCH70)
Q88P73 1.99e-57 199 37 7 348 3 pepA Probable cytosol aminopeptidase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A4SSA7 2.67e-57 199 39 6 319 3 pepA Probable cytosol aminopeptidase Aeromonas salmonicida (strain A449)
Q92QY7 4.18e-57 198 37 6 316 3 pepA Probable cytosol aminopeptidase Rhizobium meliloti (strain 1021)
C3K6G5 4.83e-57 198 39 5 322 3 pepA Probable cytosol aminopeptidase Pseudomonas fluorescens (strain SBW25)
B0KQK8 5.37e-57 198 37 7 348 3 pepA Probable cytosol aminopeptidase Pseudomonas putida (strain GB-1)
Q1IPU7 6.01e-57 198 38 6 319 3 pepA Probable cytosol aminopeptidase Koribacter versatilis (strain Ellin345)
A1BGN2 8.68e-57 197 40 5 317 3 pepA Probable cytosol aminopeptidase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q488M4 9.95e-57 197 38 7 343 3 pepA Probable cytosol aminopeptidase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q7VAP4 1.71e-56 197 37 8 342 3 pepA Probable cytosol aminopeptidase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A5VZ69 1.79e-56 197 37 7 348 3 pepA Probable cytosol aminopeptidase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B1JLS9 1.96e-56 197 38 9 344 3 pepA Probable cytosol aminopeptidase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66F09 1.96e-56 197 38 9 344 3 pepA Probable cytosol aminopeptidase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQP6 1.96e-56 197 38 9 344 3 pepA Probable cytosol aminopeptidase Yersinia pestis (strain Pestoides F)
Q1CM01 1.96e-56 197 38 9 344 3 pepA Probable cytosol aminopeptidase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R5F5 1.96e-56 197 38 9 344 3 pepA Probable cytosol aminopeptidase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBH3 1.96e-56 197 38 9 344 3 pepA Probable cytosol aminopeptidase Yersinia pestis
B2K3E9 1.96e-56 197 38 9 344 3 pepA Probable cytosol aminopeptidase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C3R8 1.96e-56 197 38 9 344 3 pepA Probable cytosol aminopeptidase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FML9 1.96e-56 197 38 9 344 3 pepA Probable cytosol aminopeptidase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
O86436 2.18e-56 196 37 6 343 1 pepA Cytosol aminopeptidase Pseudomonas putida
Q1I5F9 2.39e-56 196 38 7 341 3 pepA Probable cytosol aminopeptidase Pseudomonas entomophila (strain L48)
B5EKZ2 2.6e-56 196 40 8 335 3 pepA Probable cytosol aminopeptidase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J5I9 2.6e-56 196 40 8 335 3 pepA Probable cytosol aminopeptidase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q8UGC8 2.8e-56 196 38 6 316 3 pepA Probable cytosol aminopeptidase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2KA77 3.07e-56 196 37 6 320 3 pepA Probable cytosol aminopeptidase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B1JBA9 3.27e-56 196 38 6 325 3 pepA Probable cytosol aminopeptidase Pseudomonas putida (strain W619)
A4ISE0 3.67e-56 196 38 11 342 3 pepA Probable cytosol aminopeptidase Geobacillus thermodenitrificans (strain NG80-2)
A1WUV1 5.24e-56 196 40 5 325 3 pepA Probable cytosol aminopeptidase Halorhodospira halophila (strain DSM 244 / SL1)
C3LR42 7.46e-56 195 39 5 323 3 pepA Probable cytosol aminopeptidase Vibrio cholerae serotype O1 (strain M66-2)
P0C6E1 7.46e-56 195 39 5 323 3 pepA Cytosol aminopeptidase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5D8 7.46e-56 195 39 5 323 3 pepA Cytosol aminopeptidase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A6U7J2 7.47e-56 195 37 6 316 3 pepA Probable cytosol aminopeptidase Sinorhizobium medicae (strain WSM419)
C4LA51 7.95e-56 195 39 8 321 3 pepA Probable cytosol aminopeptidase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A0KPF3 8.64e-56 195 38 6 319 3 pepA Probable cytosol aminopeptidase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q2T0C0 9.1e-56 195 40 7 325 3 pepA Probable cytosol aminopeptidase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A0RUA5 9.69e-56 194 37 6 329 3 pepA Probable cytosol aminopeptidase Cenarchaeum symbiosum (strain A)
A3N1A7 1.03e-55 195 39 8 342 3 pepA Probable cytosol aminopeptidase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q3KHM4 1.15e-55 194 38 5 320 3 pepA Probable cytosol aminopeptidase Pseudomonas fluorescens (strain Pf0-1)
Q8KD74 1.56e-55 194 41 6 316 3 pepA Probable cytosol aminopeptidase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A7IFB7 2.35e-55 194 39 8 319 3 pepA Probable cytosol aminopeptidase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q8RHT8 2.48e-55 193 36 8 325 3 pepA Probable cytosol aminopeptidase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A1V5Z5 2.56e-55 194 39 7 325 3 pepA Probable cytosol aminopeptidase Burkholderia mallei (strain SAVP1)
Q62LH2 2.56e-55 194 39 7 325 3 pepA Probable cytosol aminopeptidase Burkholderia mallei (strain ATCC 23344)
A2SAC2 2.56e-55 194 39 7 325 3 pepA Probable cytosol aminopeptidase Burkholderia mallei (strain NCTC 10229)
A3MLR1 2.56e-55 194 39 7 325 3 pepA Probable cytosol aminopeptidase Burkholderia mallei (strain NCTC 10247)
B3PUV3 2.7e-55 194 36 6 320 3 pepA Probable cytosol aminopeptidase Rhizobium etli (strain CIAT 652)
Q63WC3 2.87e-55 194 39 7 325 3 pepA Probable cytosol aminopeptidase Burkholderia pseudomallei (strain K96243)
A3N6U4 2.87e-55 194 39 7 325 3 pepA Probable cytosol aminopeptidase Burkholderia pseudomallei (strain 668)
A3NSI1 2.87e-55 194 39 7 325 3 pepA Probable cytosol aminopeptidase Burkholderia pseudomallei (strain 1106a)
B8GTX6 3.36e-55 193 37 6 338 3 pepA Probable cytosol aminopeptidase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q3JV16 3.72e-55 193 39 7 325 3 pepA Probable cytosol aminopeptidase Burkholderia pseudomallei (strain 1710b)
C3M9C8 3.89e-55 193 37 6 316 3 pepA Probable cytosol aminopeptidase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
C4K346 4.54e-55 193 38 4 322 3 pepA Probable cytosol aminopeptidase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q82X54 4.64e-55 193 37 5 320 3 pepA Probable cytosol aminopeptidase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A4VNZ7 5.48e-55 192 39 5 319 3 pepA Probable cytosol aminopeptidase Stutzerimonas stutzeri (strain A1501)
B3GXY6 7.65e-55 192 39 8 342 3 pepA Probable cytosol aminopeptidase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A8FS02 8.22e-55 192 37 9 343 3 pepA Probable cytosol aminopeptidase Shewanella sediminis (strain HAW-EB3)
Q1MIZ4 8.32e-55 192 37 6 320 3 pepA Probable cytosol aminopeptidase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q6DA52 9.02e-55 192 37 7 323 3 pepA Probable cytosol aminopeptidase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8NNJ4 9.62e-55 192 39 7 319 3 pepA Probable cytosol aminopeptidase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q029J4 1.07e-54 191 37 8 340 3 pepA Probable cytosol aminopeptidase Solibacter usitatus (strain Ellin6076)
A9MET9 1.08e-54 192 39 7 320 3 pepA Probable cytosol aminopeptidase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
O32106 1.17e-54 192 40 12 321 3 pepA Probable cytosol aminopeptidase Bacillus subtilis (strain 168)
B9JCD8 1.4e-54 192 37 6 316 3 pepA Probable cytosol aminopeptidase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A7Z8B5 1.46e-54 191 40 11 320 3 pepA Probable cytosol aminopeptidase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A9AHG9 1.79e-54 191 38 7 326 3 pepA Probable cytosol aminopeptidase Burkholderia multivorans (strain ATCC 17616 / 249)
Q328S1 1.85e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Shigella dysenteriae serotype 1 (strain Sd197)
Q83P64 1.87e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Shigella flexneri
B1LVC3 2.01e-54 191 37 7 318 3 pepA Probable cytosol aminopeptidase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q3YU89 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Shigella sonnei (strain Ss046)
Q0SXK0 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Shigella flexneri serotype 5b (strain 8401)
Q1R2Z4 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli (strain UTI89 / UPEC)
B1LRE5 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli (strain SMS-3-5 / SECEC)
B6I2H3 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli (strain SE11)
B7NGJ2 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P68767 2.03e-54 191 39 6 319 1 pepA Cytosol aminopeptidase Escherichia coli (strain K12)
B1ISB1 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P68766 2.03e-54 191 39 6 319 3 pepA Cytosol aminopeptidase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T9D1 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AJG3 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli O1:K1 / APEC
A8A816 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli O9:H4 (strain HS)
B1XEN9 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli (strain K12 / DH10B)
C4ZRD1 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M9L9 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli O8 (strain IAI1)
B7MSZ3 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli O81 (strain ED1a)
B7NUH4 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z3L7 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P68768 2.03e-54 191 39 6 319 3 pepA Cytosol aminopeptidase Escherichia coli O157:H7
B7LCX0 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli (strain 55989 / EAEC)
B7MLR5 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UQR7 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZVE0 2.03e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q31TK2 2.14e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Shigella boydii serotype 4 (strain Sb227)
B2TYY4 2.14e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LMT2 2.14e-54 191 39 6 319 3 pepA Probable cytosol aminopeptidase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q823J9 2.31e-54 191 38 6 314 3 pepA Probable cytosol aminopeptidase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
C5BBY4 2.48e-54 191 39 7 320 3 pepA Probable cytosol aminopeptidase Edwardsiella ictaluri (strain 93-146)
Q6FFD8 2.98e-54 190 36 7 359 3 pepA Probable cytosol aminopeptidase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q8ZK29 3.05e-54 191 39 7 320 3 pepA Probable cytosol aminopeptidase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TTA0 3.05e-54 191 39 7 320 3 pepA Probable cytosol aminopeptidase Salmonella schwarzengrund (strain CVM19633)
B5BKS6 3.05e-54 191 39 7 320 3 pepA Probable cytosol aminopeptidase Salmonella paratyphi A (strain AKU_12601)
C0Q7D6 3.05e-54 191 39 7 320 3 pepA Probable cytosol aminopeptidase Salmonella paratyphi C (strain RKS4594)
A9N680 3.05e-54 191 39 7 320 3 pepA Probable cytosol aminopeptidase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJD4 3.05e-54 191 39 7 320 3 pepA Probable cytosol aminopeptidase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T3M4 3.05e-54 191 39 7 320 3 pepA Probable cytosol aminopeptidase Salmonella newport (strain SL254)
B4TG58 3.05e-54 191 39 7 320 3 pepA Probable cytosol aminopeptidase Salmonella heidelberg (strain SL476)
B5R9L5 3.05e-54 191 39 7 320 3 pepA Probable cytosol aminopeptidase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1K2 3.05e-54 191 39 7 320 3 pepA Probable cytosol aminopeptidase Salmonella enteritidis PT4 (strain P125109)
B5FSH0 3.05e-54 191 39 7 320 3 pepA Probable cytosol aminopeptidase Salmonella dublin (strain CT_02021853)
Q57GC3 3.05e-54 191 39 7 320 3 pepA Probable cytosol aminopeptidase Salmonella choleraesuis (strain SC-B67)
B5F465 3.05e-54 191 39 7 320 3 pepA Probable cytosol aminopeptidase Salmonella agona (strain SL483)
B8CU18 3.76e-54 191 36 10 344 3 pepA Probable cytosol aminopeptidase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q02RY8 4.02e-54 190 39 6 323 1 pepA Probable cytosol aminopeptidase Pseudomonas aeruginosa (strain UCBPP-PA14)
P57823 4.23e-54 190 37 9 370 3 pepA Probable cytosol aminopeptidase Pasteurella multocida (strain Pm70)
Q135P8 4.99e-54 190 37 6 325 3 pepA Probable cytosol aminopeptidase Rhodopseudomonas palustris (strain BisB5)
Q87LG8 5.08e-54 190 37 9 345 3 pepA Probable cytosol aminopeptidase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q4ZXH7 5.1e-54 190 39 5 319 3 pepA Probable cytosol aminopeptidase Pseudomonas syringae pv. syringae (strain B728a)
A6X259 6.41e-54 190 38 8 317 3 pepA Probable cytosol aminopeptidase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A5EIB4 6.47e-54 190 37 7 327 3 pepA Probable cytosol aminopeptidase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B0BQ37 6.68e-54 190 39 6 323 3 pepA Probable cytosol aminopeptidase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q2NR41 9.48e-54 189 37 5 318 3 pepA Probable cytosol aminopeptidase Sodalis glossinidius (strain morsitans)
Q984S1 9.48e-54 189 38 9 325 3 pepA Probable cytosol aminopeptidase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A4JGZ2 1.01e-53 189 38 7 326 3 pepA Probable cytosol aminopeptidase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2IX74 1.09e-53 189 37 7 324 3 pepA Probable cytosol aminopeptidase Rhodopseudomonas palustris (strain HaA2)
B5ZWY7 1.19e-53 189 36 6 320 3 pepA Probable cytosol aminopeptidase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B0CCF6 1.2e-53 189 38 11 321 3 pepA Probable cytosol aminopeptidase Acaryochloris marina (strain MBIC 11017)
A8AMA5 1.2e-53 189 39 7 320 3 pepA Probable cytosol aminopeptidase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
O68822 1.28e-53 189 38 6 323 3 pepA Cytosol aminopeptidase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7UVT6 1.28e-53 189 38 6 323 3 pepA Probable cytosol aminopeptidase Pseudomonas aeruginosa (strain LESB58)
B3QNM5 1.36e-53 189 39 6 316 3 pepA Probable cytosol aminopeptidase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q7VNH9 1.38e-53 189 37 7 343 3 pepA Probable cytosol aminopeptidase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q07LG0 1.46e-53 189 37 6 320 3 pepA Probable cytosol aminopeptidase Rhodopseudomonas palustris (strain BisA53)
Q4UKD7 1.57e-53 189 36 7 319 3 pepA Probable cytosol aminopeptidase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A8G6E3 1.66e-53 189 37 10 345 3 pepA Probable cytosol aminopeptidase Prochlorococcus marinus (strain MIT 9215)
P45334 1.86e-53 189 35 8 366 3 pepA Cytosol aminopeptidase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B5F9Q6 1.87e-53 189 37 6 324 3 pepA Probable cytosol aminopeptidase Aliivibrio fischeri (strain MJ11)
Q887M0 1.89e-53 189 39 5 319 3 pepA Probable cytosol aminopeptidase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A5UBH1 1.92e-53 188 37 6 322 3 pepA Probable cytosol aminopeptidase Haemophilus influenzae (strain PittEE)
Q4QJN7 1.92e-53 188 37 6 322 3 pepA Probable cytosol aminopeptidase Haemophilus influenzae (strain 86-028NP)
C0QC86 2.04e-53 189 42 8 292 3 pepA Probable cytosol aminopeptidase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q11HH5 2.06e-53 188 37 7 316 3 pepA Probable cytosol aminopeptidase Chelativorans sp. (strain BNC1)
A4G7P5 2.18e-53 189 37 6 326 3 pepA Probable cytosol aminopeptidase Herminiimonas arsenicoxydans
A7MSE5 2.32e-53 189 37 7 322 3 pepA Probable cytosol aminopeptidase Vibrio campbellii (strain ATCC BAA-1116)
Q2YB18 2.35e-53 189 36 5 321 3 pepA Probable cytosol aminopeptidase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q7MHG4 2.55e-53 188 37 5 324 3 pepA Probable cytosol aminopeptidase Vibrio vulnificus (strain YJ016)
Q8DCE5 2.55e-53 188 37 5 324 3 pepA Probable cytosol aminopeptidase Vibrio vulnificus (strain CMCP6)
Q5L681 2.72e-53 188 38 6 314 3 pepA Probable cytosol aminopeptidase Chlamydia abortus (strain DSM 27085 / S26/3)
Q6LUW0 2.77e-53 188 36 7 324 3 pepA Probable cytosol aminopeptidase Photobacterium profundum (strain SS9)
A0PTP9 3.59e-53 188 38 7 321 3 pepA Probable cytosol aminopeptidase Mycobacterium ulcerans (strain Agy99)
Q6NG90 3.6e-53 188 38 7 317 3 pepA Probable cytosol aminopeptidase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q89MT4 3.64e-53 188 36 7 325 3 pepA Probable cytosol aminopeptidase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A8G978 3.78e-53 188 36 9 344 3 pepA Probable cytosol aminopeptidase Serratia proteamaculans (strain 568)
Q8Z116 4.15e-53 188 39 7 320 3 pepA Probable cytosol aminopeptidase Salmonella typhi
A6T0V4 4.28e-53 188 36 6 326 3 pepA Probable cytosol aminopeptidase Janthinobacterium sp. (strain Marseille)
C1AUB5 4.45e-53 188 40 7 317 3 pepA Probable cytosol aminopeptidase Rhodococcus opacus (strain B4)
Q7MZ27 4.54e-53 188 38 7 320 3 pepA Probable cytosol aminopeptidase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C1F4B7 4.63e-53 188 39 11 360 3 pepA Probable cytosol aminopeptidase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
C6DJN2 4.9e-53 187 37 7 323 3 pepA Probable cytosol aminopeptidase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q9A7M9 4.94e-53 187 38 10 325 3 pepA Probable cytosol aminopeptidase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B2HGY2 5.26e-53 188 38 7 321 3 pepA Probable cytosol aminopeptidase Mycobacterium marinum (strain ATCC BAA-535 / M)
A4WRK9 5.28e-53 187 36 6 337 3 pepA Probable cytosol aminopeptidase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q12QW7 5.44e-53 187 36 7 342 3 pepA Probable cytosol aminopeptidase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A5UFE2 5.55e-53 187 37 6 322 3 pepA Probable cytosol aminopeptidase Haemophilus influenzae (strain PittGG)
Q68XM6 5.63e-53 187 36 6 319 3 pepA Probable cytosol aminopeptidase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A5CXK2 6.25e-53 187 35 9 328 3 pepA Probable cytosol aminopeptidase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q0SHL0 6.47e-53 187 40 7 317 3 pepA Probable cytosol aminopeptidase Rhodococcus jostii (strain RHA1)
B2VL42 6.62e-53 187 37 5 318 3 pepA Probable cytosol aminopeptidase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A5CRI6 6.63e-53 187 38 7 324 3 pepA Probable cytosol aminopeptidase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
A8F0Q0 6.71e-53 187 35 6 319 3 pepA Probable cytosol aminopeptidase Rickettsia massiliae (strain Mtu5)
Q3SS04 6.85e-53 187 37 6 327 3 pepA Probable cytosol aminopeptidase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A4WF25 6.9e-53 187 38 7 320 3 pepA Probable cytosol aminopeptidase Enterobacter sp. (strain 638)
Q39DS5 7.27e-53 187 38 7 326 3 pepA Probable cytosol aminopeptidase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A2BSQ4 7.59e-53 187 36 10 344 3 pepA Probable cytosol aminopeptidase Prochlorococcus marinus (strain AS9601)
Q606B9 9.2e-53 187 33 8 386 3 pepA Probable cytosol aminopeptidase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q5E7T8 9.94e-53 187 37 6 324 3 pepA Probable cytosol aminopeptidase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A1JJ31 1.06e-52 187 36 9 344 3 pepA Probable cytosol aminopeptidase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A6V0T2 1.08e-52 186 38 6 323 3 pepA Probable cytosol aminopeptidase Pseudomonas aeruginosa (strain PA7)
Q6N5B9 1.42e-52 186 36 7 337 3 pepA Probable cytosol aminopeptidase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A1SRZ1 1.5e-52 186 36 5 318 3 pepA Probable cytosol aminopeptidase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B3Q9R8 1.53e-52 186 36 7 337 3 pepA Probable cytosol aminopeptidase Rhodopseudomonas palustris (strain TIE-1)
A6THI2 1.6e-52 186 39 7 320 3 pepA Probable cytosol aminopeptidase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A3QBG2 1.65e-52 186 37 9 343 3 pepA Probable cytosol aminopeptidase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q15PX4 1.78e-52 186 36 8 328 3 pepA Probable cytosol aminopeptidase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q8YG99 1.92e-52 186 37 8 317 3 pepA Probable cytosol aminopeptidase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q0I816 1.97e-52 186 37 8 320 3 pepA Probable cytosol aminopeptidase Synechococcus sp. (strain CC9311)
Q74GB4 1.99e-52 186 39 5 319 3 pepA Probable cytosol aminopeptidase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B5Y2T8 2.08e-52 186 39 7 320 3 pepA Probable cytosol aminopeptidase Klebsiella pneumoniae (strain 342)
B8F6N9 2.29e-52 186 42 6 271 3 pepA Probable cytosol aminopeptidase Glaesserella parasuis serovar 5 (strain SH0165)
Q8EH62 2.38e-52 186 37 10 346 3 pepA2 Probable cytosol aminopeptidase 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8G1M4 2.79e-52 186 37 8 317 3 pepA Probable cytosol aminopeptidase Brucella suis biovar 1 (strain 1330)
B4E8G9 2.89e-52 186 38 7 326 3 pepA Probable cytosol aminopeptidase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q31ET3 2.99e-52 185 31 14 427 3 pepA Probable cytosol aminopeptidase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A5VPM3 3.01e-52 186 37 8 317 3 pepA Probable cytosol aminopeptidase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
B1JWV2 3.05e-52 186 38 7 326 3 pepA Probable cytosol aminopeptidase Burkholderia orbicola (strain MC0-3)
Q1H4U4 3.24e-52 185 37 6 324 3 pepA Probable cytosol aminopeptidase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
C1AQC8 3.28e-52 186 38 7 321 3 pepA Probable cytosol aminopeptidase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KKQ5 3.28e-52 186 38 7 321 3 pepA Probable cytosol aminopeptidase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7VEN5 3.28e-52 186 38 7 321 3 pepA Probable cytosol aminopeptidase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q0AIF5 3.3e-52 185 32 9 420 3 pepA Probable cytosol aminopeptidase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q7M8W6 3.34e-52 185 36 6 325 3 pepA Probable cytosol aminopeptidase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A8EXL1 3.69e-52 185 36 7 319 3 pepA Probable cytosol aminopeptidase Rickettsia canadensis (strain McKiel)
A8GQW7 3.73e-52 185 32 10 423 3 pepA Probable cytosol aminopeptidase Rickettsia rickettsii (strain Sheila Smith)
B0BWB2 3.73e-52 185 32 10 423 3 pepA Probable cytosol aminopeptidase Rickettsia rickettsii (strain Iowa)
Q65FE6 3.78e-52 185 38 11 326 3 pepA Probable cytosol aminopeptidase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B2JET5 3.87e-52 185 38 7 326 3 pepA Probable cytosol aminopeptidase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A8GXC3 4.3e-52 185 35 7 319 3 pepA Probable cytosol aminopeptidase Rickettsia bellii (strain OSU 85-389)
P28838 4.36e-52 186 37 5 318 1 LAP3 Cytosol aminopeptidase Homo sapiens
Q1RJN2 4.39e-52 185 35 7 319 3 pepA Probable cytosol aminopeptidase Rickettsia bellii (strain RML369-C)
C4K1N6 4.54e-52 185 36 7 319 3 pepA Probable cytosol aminopeptidase Rickettsia peacockii (strain Rustic)
C6E543 4.68e-52 185 35 7 363 3 pepA Probable cytosol aminopeptidase Geobacter sp. (strain M21)
B6EMT2 5.57e-52 185 36 10 350 3 pepA Probable cytosol aminopeptidase Aliivibrio salmonicida (strain LFI1238)
Q1BUE7 5.68e-52 185 38 7 326 3 pepA Probable cytosol aminopeptidase Burkholderia orbicola (strain AU 1054)
A0K9N9 5.68e-52 185 38 7 326 3 pepA Probable cytosol aminopeptidase Burkholderia cenocepacia (strain HI2424)
Q254B9 5.82e-52 185 38 6 314 3 pepA Probable cytosol aminopeptidase Chlamydia felis (strain Fe/C-56)
Q73QZ3 6.45e-52 184 33 8 348 3 pepA Probable cytosol aminopeptidase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
B8HTK3 6.51e-52 184 38 8 319 3 pepA Probable cytosol aminopeptidase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q9Z8F8 6.67e-52 184 38 8 315 3 pepA Probable cytosol aminopeptidase Chlamydia pneumoniae
Q92J85 9.48e-52 184 36 7 319 3 pepA Probable cytosol aminopeptidase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
C3PMI0 9.48e-52 184 36 7 319 3 pepA Probable cytosol aminopeptidase Rickettsia africae (strain ESF-5)
Q47BG9 1.11e-51 184 36 5 316 3 pepA Probable cytosol aminopeptidase Dechloromonas aromatica (strain RCB)
P9WHT3 1.11e-51 184 38 7 321 1 pepA Probable cytosol aminopeptidase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHT2 1.11e-51 184 38 7 321 3 pepA Probable cytosol aminopeptidase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U4P1 1.11e-51 184 38 7 321 3 pepA Probable cytosol aminopeptidase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q11A96 1.4e-51 184 38 9 322 3 pepA Probable cytosol aminopeptidase Trichodesmium erythraeum (strain IMS101)
O32956 1.76e-51 184 37 7 323 3 pepA Probable cytosol aminopeptidase Mycobacterium leprae (strain TN)
Q8K9I0 1.76e-51 183 40 4 282 3 pepA Probable cytosol aminopeptidase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B8D7Q4 1.94e-51 183 37 8 337 3 pepA Probable cytosol aminopeptidase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
C1A138 1.94e-51 183 40 8 317 3 pepA Probable cytosol aminopeptidase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q73IU2 2.08e-51 183 36 9 322 3 pepA Probable cytosol aminopeptidase Wolbachia pipientis wMel
Q319F5 2.32e-51 183 37 9 321 3 pepA Probable cytosol aminopeptidase Prochlorococcus marinus (strain MIT 9312)
Q086N8 2.56e-51 183 36 5 319 3 pepA Probable cytosol aminopeptidase Shewanella frigidimarina (strain NCIMB 400)
A3PEG6 2.73e-51 182 36 10 343 3 pepA Probable cytosol aminopeptidase Prochlorococcus marinus (strain MIT 9301)
P27888 2.79e-51 183 35 6 319 3 pepA Cytosol aminopeptidase Rickettsia prowazekii (strain Madrid E)
B8D9F2 3.16e-51 183 37 8 337 3 pepA Probable cytosol aminopeptidase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q9JTI8 3.35e-51 182 38 13 360 3 pepA Probable cytosol aminopeptidase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P57448 3.36e-51 182 37 8 337 3 pepA Cytosol aminopeptidase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B9JUW1 3.66e-51 182 35 7 324 3 pepA Probable cytosol aminopeptidase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A5G9C7 4.16e-51 182 36 7 322 3 pepA Probable cytosol aminopeptidase Geotalea uraniireducens (strain Rf4)
A5GN62 4.58e-51 182 38 7 325 3 pepA Probable cytosol aminopeptidase Synechococcus sp. (strain WH7803)
B8J457 4.72e-51 182 38 7 316 3 pepA Probable cytosol aminopeptidase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q0BCQ2 4.8e-51 182 37 6 326 3 pepA Probable cytosol aminopeptidase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
O84049 5.76e-51 182 38 6 312 1 pepA Probable cytosol aminopeptidase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q5QY05 5.99e-51 182 36 7 324 3 pepA Probable cytosol aminopeptidase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q215R8 6.26e-51 182 35 6 329 3 pepA Probable cytosol aminopeptidase Rhodopseudomonas palustris (strain BisB18)
Q8DI46 6.48e-51 182 36 10 353 3 pepA Probable cytosol aminopeptidase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q2SKR0 6.92e-51 182 39 6 309 3 pepA Probable cytosol aminopeptidase Hahella chejuensis (strain KCTC 2396)
B1ZAK8 7.72e-51 182 37 9 318 3 pepA Probable cytosol aminopeptidase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q8EI85 7.93e-51 182 35 14 409 3 pepA1 Probable cytosol aminopeptidase 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q143Y9 8.5e-51 182 38 7 326 3 pepA Probable cytosol aminopeptidase Paraburkholderia xenovorans (strain LB400)
Q893F8 9.2e-51 181 34 9 369 3 pepA Probable cytosol aminopeptidase Clostridium tetani (strain Massachusetts / E88)
B1YUW5 1.05e-50 181 37 6 326 3 pepA Probable cytosol aminopeptidase Burkholderia ambifaria (strain MC40-6)
B2T146 1.23e-50 181 38 7 326 3 pepA Probable cytosol aminopeptidase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q68FS4 1.29e-50 181 37 6 319 1 Lap3 Cytosol aminopeptidase Rattus norvegicus
Q7NHC6 1.32e-50 181 35 7 320 3 pepA Probable cytosol aminopeptidase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A3Q1S2 1.35e-50 181 36 5 323 3 pepA Probable cytosol aminopeptidase Mycobacterium sp. (strain JLS)
P00727 1.56e-50 181 36 6 319 1 LAP3 Cytosol aminopeptidase Bos taurus
Q3KMX6 1.64e-50 181 38 6 312 3 pepA Probable cytosol aminopeptidase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q0K7F5 1.67e-50 181 37 7 324 3 pepA Probable cytosol aminopeptidase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B3R663 1.69e-50 181 37 7 324 3 pepA Probable cytosol aminopeptidase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q1LJJ6 1.88e-50 181 37 7 324 3 pepA Probable cytosol aminopeptidase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B1VZN5 1.91e-50 181 38 11 377 3 pepA Probable cytosol aminopeptidase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
P38019 2.36e-50 180 38 6 314 3 pepA Probable cytosol aminopeptidase Chlamydia muridarum (strain MoPn / Nigg)
Q1B6R7 2.39e-50 181 36 5 323 3 pepA Probable cytosol aminopeptidase Mycobacterium sp. (strain MCS)
A1UIA8 2.39e-50 181 36 5 323 3 pepA Probable cytosol aminopeptidase Mycobacterium sp. (strain KMS)
Q3B4B5 2.6e-50 181 40 5 320 3 pepA Probable cytosol aminopeptidase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q9CPY7 3.18e-50 181 37 6 319 1 Lap3 Cytosol aminopeptidase Mus musculus
P28839 3.9e-50 180 38 7 321 1 LAP3 Cytosol aminopeptidase Sus scrofa
Q0I236 4.41e-50 179 32 7 373 3 pepA Probable cytosol aminopeptidase Histophilus somni (strain 129Pt)
B3R0N4 5.18e-50 179 35 10 325 3 pepA Probable cytosol aminopeptidase Phytoplasma mali (strain AT)
B0UVX4 5.48e-50 179 35 6 323 3 pepA Probable cytosol aminopeptidase Histophilus somni (strain 2336)
Q46XT9 5.55e-50 180 37 7 324 3 pepA Probable cytosol aminopeptidase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8D295 5.89e-50 179 34 9 348 3 pepA Probable cytosol aminopeptidase Wigglesworthia glossinidia brevipalpis
Q3JEC8 7.03e-50 179 36 9 326 3 pepA Probable cytosol aminopeptidase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B7KYK4 7.08e-50 179 37 8 318 3 pepA Probable cytosol aminopeptidase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
C5CCM4 8.74e-50 179 38 7 334 3 pepA Probable cytosol aminopeptidase Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
B0BB32 1e-49 179 38 6 312 3 pepA Probable cytosol aminopeptidase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B9F3 1e-49 179 38 6 312 3 pepA Probable cytosol aminopeptidase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
A6TWW9 1.2e-49 179 38 8 316 3 pepA Probable cytosol aminopeptidase Alkaliphilus metalliredigens (strain QYMF)
C5BMG6 1.21e-49 179 36 6 320 3 pepA Probable cytosol aminopeptidase Teredinibacter turnerae (strain ATCC 39867 / T7901)
C0QSL9 1.22e-49 178 35 7 325 3 pepA Probable cytosol aminopeptidase Persephonella marina (strain DSM 14350 / EX-H1)
Q0AB75 1.22e-49 178 36 6 329 3 pepA Probable cytosol aminopeptidase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q0VSA5 1.25e-49 178 38 8 326 3 pepA Probable cytosol aminopeptidase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A9VXD6 1.26e-49 178 37 8 318 3 pepA Probable cytosol aminopeptidase Methylorubrum extorquens (strain PA1)
Q1QKW6 1.34e-49 178 36 6 325 3 pepA Probable cytosol aminopeptidase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q83G32 1.8e-49 178 39 7 318 3 pepA Probable cytosol aminopeptidase Tropheryma whipplei (strain Twist)
Q83I32 1.8e-49 178 39 7 318 3 pepA Probable cytosol aminopeptidase Tropheryma whipplei (strain TW08/27)
A6VMX3 2.16e-49 177 37 8 325 3 pepA Probable cytosol aminopeptidase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B2UAK8 2.35e-49 178 39 8 325 3 pepA Probable cytosol aminopeptidase Ralstonia pickettii (strain 12J)
Q7VGF0 2.43e-49 177 35 4 321 3 pepA Probable cytosol aminopeptidase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q6A9W5 3.12e-49 177 38 9 342 3 pepA Probable cytosol aminopeptidase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q7NTY9 3.83e-49 177 40 6 280 3 pepA Probable cytosol aminopeptidase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1LTH8 5.22e-49 177 35 7 318 3 pepA Probable cytosol aminopeptidase Baumannia cicadellinicola subsp. Homalodisca coagulata
B1V932 5.58e-49 177 35 7 321 3 pepA Probable cytosol aminopeptidase Phytoplasma australiense
Q65SA3 6.09e-49 176 35 9 370 3 pepA Probable cytosol aminopeptidase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0VMG3 6.56e-49 176 39 5 282 3 pepA Probable cytosol aminopeptidase Acinetobacter baumannii (strain SDF)
B0VDC8 8.41e-49 176 39 5 282 3 pepA Probable cytosol aminopeptidase Acinetobacter baumannii (strain AYE)
A3M1A8 8.41e-49 176 39 5 282 3 pepA Probable cytosol aminopeptidase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2I1U0 8.41e-49 176 39 5 282 3 pepA Probable cytosol aminopeptidase Acinetobacter baumannii (strain ACICU)
B7I309 8.41e-49 176 39 5 282 3 pepA Probable cytosol aminopeptidase Acinetobacter baumannii (strain AB0057)
B7H1P9 8.41e-49 176 39 5 282 3 pepA Probable cytosol aminopeptidase Acinetobacter baumannii (strain AB307-0294)
Q8FNP8 8.78e-49 176 38 7 335 3 pepA Probable cytosol aminopeptidase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q5NXM1 1.45e-48 176 36 5 318 3 pepA Probable cytosol aminopeptidase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q8XWQ8 1.76e-48 176 39 8 327 3 pepA Probable cytosol aminopeptidase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q315M7 1.81e-48 176 35 8 331 3 pepA Probable cytosol aminopeptidase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q7V5X8 1.88e-48 175 39 9 324 3 pepA Probable cytosol aminopeptidase Prochlorococcus marinus (strain MIT 9313)
P30184 2.6e-48 175 36 9 334 1 LAP1 Leucine aminopeptidase 1 Arabidopsis thaliana
Q5HAP2 3.24e-48 175 35 7 320 3 pepA Probable cytosol aminopeptidase Ehrlichia ruminantium (strain Welgevonden)
C5CLU5 3.38e-48 175 36 8 326 3 pepA Probable cytosol aminopeptidase Variovorax paradoxus (strain S110)
Q5FFZ5 4.19e-48 174 35 7 320 3 pepA Probable cytosol aminopeptidase Ehrlichia ruminantium (strain Gardel)
Q2JRU4 5.5e-48 174 38 6 319 3 pepA Probable cytosol aminopeptidase Synechococcus sp. (strain JA-3-3Ab)
Q7V0D4 6.87e-48 174 35 9 335 3 pepA Probable cytosol aminopeptidase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q6K669 7.04e-48 176 37 10 327 2 Os02g0794700 Leucine aminopeptidase 2, chloroplastic Oryza sativa subsp. japonica
Q72UC6 7.17e-48 174 36 8 345 3 pepA Probable cytosol aminopeptidase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8F0Q1 7.63e-48 174 36 8 345 3 pepA Probable cytosol aminopeptidase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q8SQZ7 7.94e-48 173 35 4 320 1 ECU10_1770i Cytosol aminopeptidase Encephalitozoon cuniculi (strain GB-M1)
A9BBV5 1.02e-47 173 34 9 354 3 pepA Probable cytosol aminopeptidase Prochlorococcus marinus (strain MIT 9211)
Q7U8Q1 1.26e-47 173 40 7 281 3 pepA Probable cytosol aminopeptidase Parasynechococcus marenigrum (strain WH8102)
Q2KWX0 1.66e-47 173 42 8 275 3 pepA Probable cytosol aminopeptidase Bordetella avium (strain 197N)
B1YKV4 1.96e-47 172 38 9 281 3 pepA Probable cytosol aminopeptidase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B4SJ73 2.22e-47 172 36 7 325 3 pepA Probable cytosol aminopeptidase Stenotrophomonas maltophilia (strain R551-3)
Q6MC72 2.23e-47 172 34 7 320 3 pepA Probable cytosol aminopeptidase Protochlamydia amoebophila (strain UWE25)
Q7VQT0 2.62e-47 172 38 7 293 3 pepA Probable cytosol aminopeptidase Blochmanniella floridana
Q73YK2 2.72e-47 172 38 6 320 3 pepA Probable cytosol aminopeptidase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q8PCR4 3.11e-47 172 36 4 291 3 pepA Probable cytosol aminopeptidase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVI0 3.11e-47 172 36 4 291 3 pepA Probable cytosol aminopeptidase Xanthomonas campestris pv. campestris (strain B100)
Q4UQP6 3.11e-47 172 36 4 291 3 pepA Probable cytosol aminopeptidase Xanthomonas campestris pv. campestris (strain 8004)
Q944P7 3.54e-47 173 35 10 336 2 LAP2 Leucine aminopeptidase 2, chloroplastic Arabidopsis thaliana
Q5XGB9 3.6e-47 172 36 7 314 2 lap3 Cytosol aminopeptidase Xenopus tropicalis
Q82AN2 4.34e-47 172 39 6 335 3 pepA Probable cytosol aminopeptidase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q5H4N2 5.35e-47 171 37 5 291 1 pepA Probable cytosol aminopeptidase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SPE7 5.35e-47 171 37 5 291 3 pepA Probable cytosol aminopeptidase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P7G2 5.35e-47 171 37 5 291 3 pepA Probable cytosol aminopeptidase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BPA1 8.51e-47 171 37 5 291 3 pepA Probable cytosol aminopeptidase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B0JL23 8.59e-47 171 37 9 314 3 pepA Probable cytosol aminopeptidase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q89AG2 8.7e-47 171 35 5 320 3 pepA Probable cytosol aminopeptidase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q5FU70 8.96e-47 171 35 9 315 3 pepA Probable cytosol aminopeptidase Gluconobacter oxydans (strain 621H)
B1XK83 1.29e-46 170 36 10 325 3 pepA Probable cytosol aminopeptidase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q8PGR0 2.45e-46 169 37 5 291 3 pepA Probable cytosol aminopeptidase Xanthomonas axonopodis pv. citri (strain 306)
Q6MH10 2.64e-46 169 36 6 296 3 pepA Probable cytosol aminopeptidase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
O67868 3.52e-46 169 34 9 325 3 pepA Probable cytosol aminopeptidase Aquifex aeolicus (strain VF5)
B6JGL8 4.74e-46 169 35 6 316 3 pepA Probable cytosol aminopeptidase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q2QSB9 5.13e-46 169 36 10 348 3 Os12g0434400 Putative leucine aminopeptidase 1 Oryza sativa subsp. japonica
B7K4A4 6.7e-46 168 35 11 321 3 pepA Probable cytosol aminopeptidase Rippkaea orientalis (strain PCC 8801 / RF-1)
B2FMS4 7.65e-46 168 36 7 325 3 pepA Probable cytosol aminopeptidase Stenotrophomonas maltophilia (strain K279a)
B2J3G8 1.23e-45 167 37 7 322 3 pepA Probable cytosol aminopeptidase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q5N569 1.53e-45 167 34 10 381 3 pepA Probable cytosol aminopeptidase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q7VW48 2.43e-45 167 39 7 326 3 pepA Probable cytosol aminopeptidase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WD42 2.43e-45 167 39 7 326 3 pepA Probable cytosol aminopeptidase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q6AJZ3 2.43e-45 167 40 5 264 3 pepA Probable cytosol aminopeptidase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q9S2Q7 2.91e-45 167 39 6 332 3 pepA Probable cytosol aminopeptidase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q7W5K6 2.95e-45 167 39 7 326 3 pepA Probable cytosol aminopeptidase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
B9DIX2 3.08e-45 167 37 9 321 3 pepA Probable cytosol aminopeptidase Staphylococcus carnosus (strain TM300)
Q21WL3 3.19e-45 166 37 11 323 3 pepA Probable cytosol aminopeptidase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A8LI79 3.32e-45 166 34 7 318 3 pepA Probable cytosol aminopeptidase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
O06865 3.4e-45 166 34 10 381 3 pepA Probable cytosol aminopeptidase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8IL11 3.71e-45 168 34 8 326 1 LAP Leucine aminopeptidase Plasmodium falciparum (isolate 3D7)
A5K3U9 3.72e-45 169 34 7 329 1 LAP Leucine aminopeptidase Plasmodium vivax (strain Salvador I)
Q3AZE8 4e-45 166 38 8 288 3 pepA Probable cytosol aminopeptidase Synechococcus sp. (strain CC9902)
A1K9L5 4.3e-45 166 35 5 318 3 pepA Probable cytosol aminopeptidase Azoarcus sp. (strain BH72)
Q2JKL5 4.68e-45 166 37 6 319 3 pepA Probable cytosol aminopeptidase Synechococcus sp. (strain JA-2-3B'a(2-13))
B7KCB0 4.82e-45 166 36 10 320 3 pepA Probable cytosol aminopeptidase Gloeothece citriformis (strain PCC 7424)
Q5YZ53 5.6e-45 166 37 6 317 3 pepA Probable cytosol aminopeptidase Nocardia farcinica (strain IFM 10152)
A1WSK3 6.13e-45 166 37 9 324 3 pepA Probable cytosol aminopeptidase Verminephrobacter eiseniae (strain EF01-2)
Q8RX72 6.73e-45 167 35 10 334 2 LAP3 Leucine aminopeptidase 3, chloroplastic Arabidopsis thaliana
Q21KZ5 7.47e-45 166 34 5 319 3 pepA Probable cytosol aminopeptidase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
P31427 1.06e-44 166 34 13 348 2 LAP Leucine aminopeptidase, chloroplastic Solanum tuberosum
A0LK12 1.23e-44 165 35 6 318 3 pepA Probable cytosol aminopeptidase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q3M9J6 1.37e-44 165 37 7 320 3 pepA Probable cytosol aminopeptidase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8Z064 1.58e-44 164 37 7 320 3 pepA Probable cytosol aminopeptidase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B9MJ44 2.15e-44 164 36 9 326 3 pepA Probable cytosol aminopeptidase Acidovorax ebreus (strain TPSY)
B2V6F5 2.64e-44 164 33 8 345 3 pepA Probable cytosol aminopeptidase Sulfurihydrogenibium sp. (strain YO3AOP1)
A1W776 2.86e-44 164 36 9 326 3 pepA Probable cytosol aminopeptidase Acidovorax sp. (strain JS42)
Q87F32 4.52e-44 163 35 5 293 3 pepA Probable cytosol aminopeptidase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6L3 4.52e-44 163 35 5 293 3 pepA Probable cytosol aminopeptidase Xylella fastidiosa (strain M23)
B0U1L5 4.66e-44 163 35 5 293 3 pepA Probable cytosol aminopeptidase Xylella fastidiosa (strain M12)
Q1QTE5 5.11e-44 164 37 9 345 3 pepA Probable cytosol aminopeptidase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q72F03 6.74e-44 163 36 9 319 3 pepA Probable cytosol aminopeptidase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A2SH61 8.99e-44 162 36 7 323 3 pepA Probable cytosol aminopeptidase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
P73971 9.6e-44 162 35 11 321 3 pepA Probable cytosol aminopeptidase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9PH08 9.83e-44 162 35 5 293 3 pepA Probable cytosol aminopeptidase Xylella fastidiosa (strain 9a5c)
Q5V9F0 1.48e-43 162 33 8 374 1 lap Cytosol aminopeptidase Dictyostelium discoideum
Q3AHT4 3.3e-43 161 33 7 353 3 pepA Probable cytosol aminopeptidase Synechococcus sp. (strain CC9605)
A9IIK3 5.88e-43 160 37 7 325 3 pepA Probable cytosol aminopeptidase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B1WR01 8.68e-43 160 34 11 322 3 pepA Probable cytosol aminopeptidase Crocosphaera subtropica (strain ATCC 51142 / BH68)
A5GV03 2.34e-42 159 41 7 273 3 pepA Probable cytosol aminopeptidase Synechococcus sp. (strain RCC307)
Q10712 4.19e-42 159 34 14 346 1 LAPA1 Leucine aminopeptidase 1, chloroplastic Solanum lycopersicum
P47707 5.76e-42 158 36 6 296 3 pepA Probable cytosol aminopeptidase Metamycoplasma salivarium
Q67NI4 2.51e-41 156 35 6 314 3 pepA Probable cytosol aminopeptidase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q09735 2.93e-41 156 35 4 312 3 SPAC13A11.05 Putative aminopeptidase C13A11.05 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B3QVE8 3.59e-41 155 36 7 294 3 pepA Probable cytosol aminopeptidase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q9Y935 5.51e-41 155 34 9 333 3 pepA Probable cytosol aminopeptidase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q12AW5 1.35e-40 154 34 8 325 3 pepA Probable cytosol aminopeptidase Polaromonas sp. (strain JS666 / ATCC BAA-500)
P34629 3.29e-40 153 36 12 324 1 lap-1 Leucine aminopeptidase 1 Caenorhabditis elegans
A1VP99 6.23e-40 152 35 9 320 3 pepA Probable cytosol aminopeptidase Polaromonas naphthalenivorans (strain CJ2)
B5Z6U1 6.66e-40 152 33 5 327 3 pepA Probable cytosol aminopeptidase Helicobacter pylori (strain G27)
Q9PP04 9.71e-40 151 33 4 321 3 pepA Probable cytosol aminopeptidase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q1CTV6 3.18e-39 150 34 6 329 3 pepA Probable cytosol aminopeptidase Helicobacter pylori (strain HPAG1)
Q17W06 6.92e-39 149 33 6 329 3 pepA Probable cytosol aminopeptidase Helicobacter acinonychis (strain Sheeba)
O25294 1.18e-38 149 33 6 329 1 pepA Cytosol aminopeptidase Helicobacter pylori (strain ATCC 700392 / 26695)
B6JLF2 1.2e-38 149 33 6 329 3 pepA Probable cytosol aminopeptidase Helicobacter pylori (strain P12)
Q42876 2.32e-38 149 36 11 326 2 LAPA2 Leucine aminopeptidase 2, chloroplastic Solanum lycopersicum
Q9ZLR1 2.69e-38 147 33 6 329 3 pepA Cytosol aminopeptidase Helicobacter pylori (strain J99 / ATCC 700824)
B2UTQ8 2.75e-38 147 33 6 329 3 pepA Probable cytosol aminopeptidase Helicobacter pylori (strain Shi470)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07170
Feature type CDS
Gene pepB
Product aminopeptidase PepB
Location 1493451 - 1494746 (strand: -1)
Length 1296 (nucleotides) / 431 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_519
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00883 Cytosol aminopeptidase family, catalytic domain
PF12404 Peptidase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0260 Amino acid transport and metabolism (E) E Leucyl aminopeptidase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07751 PepB aminopeptidase [EC:3.4.11.23] Glutathione metabolism
Metabolic pathways		 -

Protein Sequence

MTQLIMPVTLSYEPASPAWGEKALVSATDNGMTIHLSQKGMLCAVQRAGRKIDGQGIRNVILSGSNWDLETSWAFWQGFRAPKGARSIEWPELPEADKAELEHRIRIIDWVRDVINTPAEELGPEQLAQRAVDLLCSVSCGSVGYRIIKGEDLREQGYMGIHTVGRGSSRSPVLLALDYNPGKQDNTPVFASLVGKGITFDSGGYSLKPSSGMESMKSDMGGAATLTGALAMAICGGLQKRVKLYLCIADNLISGNAFKLGDIIRYSNGKSVEILNTDAEGRLVLADGLIEAGKDNAGFIIDAATLTGAAKTAVGNDYHSVMSFDDALYNDLMAAADQEKELFWRLPLAEFHRLQTPSSFADLSNTGAPNTAGASTAAAFLSHFVENYRKNWLHIDCSATYRKSPSDMWAAGATGYGVRTVATLLLKKAGK

Flanking regions ( +/- flanking 50bp)

GATAAAATCGGATTGTGACTCACAATCATAAAATCAAAAGAGAGAATATAATGACGCAACTAATCATGCCCGTAACCCTGTCATACGAACCCGCCTCTCCGGCATGGGGAGAAAAAGCCCTTGTCAGCGCAACTGATAACGGAATGACCATTCATTTAAGTCAGAAAGGAATGCTGTGTGCGGTTCAGCGCGCCGGGCGTAAAATTGACGGTCAGGGGATCCGCAATGTGATCCTGAGCGGCAGTAACTGGGATCTGGAAACAAGCTGGGCATTCTGGCAGGGTTTCCGTGCGCCGAAAGGTGCCCGCTCCATTGAGTGGCCTGAATTACCGGAAGCCGATAAAGCTGAATTAGAGCACCGCATCCGTATCATTGACTGGGTGCGTGATGTCATCAACACCCCTGCAGAAGAGCTGGGACCGGAACAACTGGCACAGCGTGCCGTTGATTTACTGTGCAGCGTTTCCTGCGGATCAGTCGGCTACCGTATTATTAAAGGCGAAGATTTACGCGAGCAGGGCTATATGGGTATCCATACTGTGGGTCGCGGGTCTTCGCGCTCACCGGTTCTGTTAGCGCTGGATTACAATCCGGGCAAACAGGATAACACCCCGGTTTTCGCCAGCCTGGTTGGTAAAGGGATCACCTTTGATTCCGGCGGCTACAGCCTGAAACCGTCTTCCGGTATGGAATCTATGAAATCGGATATGGGCGGTGCGGCAACACTGACCGGCGCACTGGCAATGGCTATCTGTGGTGGTCTGCAAAAACGTGTCAAACTGTATCTGTGCATCGCGGACAACCTGATCAGCGGCAACGCATTCAAACTGGGTGATATTATCCGTTACAGTAATGGTAAATCCGTTGAGATCCTCAATACCGATGCAGAAGGGCGTCTGGTGCTGGCGGATGGATTGATCGAAGCCGGTAAAGATAATGCCGGGTTTATTATTGATGCCGCGACGCTGACCGGGGCGGCCAAAACAGCCGTCGGTAATGATTACCACTCTGTCATGAGTTTCGATGATGCATTATATAACGACCTGATGGCAGCAGCCGATCAGGAAAAAGAGCTGTTCTGGCGTCTGCCGCTGGCAGAATTCCACCGCCTGCAAACACCGTCATCATTCGCTGACCTGAGCAATACCGGTGCGCCGAATACGGCGGGTGCAAGTACGGCAGCGGCATTCCTGTCACACTTTGTGGAAAACTACCGCAAAAACTGGTTGCATATTGACTGCTCTGCGACCTACCGCAAATCGCCGTCAGACATGTGGGCGGCGGGTGCGACCGGCTATGGTGTCCGCACAGTTGCGACACTGCTGCTGAAAAAAGCCGGAAAGTAACACGTATTACGGCAATTTAGTTATCTTTATCAGTAATTTGACGGTCACGG