Homologs in group_502

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00965 FBDBKF_00965 88.5 Morganella morganii S1 - Phosphatidylethanolamine N-methyltransferase
EHELCC_00580 EHELCC_00580 88.5 Morganella morganii S2 - Phosphatidylethanolamine N-methyltransferase
NLDBIP_02880 NLDBIP_02880 88.5 Morganella morganii S4 - Phosphatidylethanolamine N-methyltransferase
LHKJJB_04395 LHKJJB_04395 88.5 Morganella morganii S3 - Phosphatidylethanolamine N-methyltransferase
HKOGLL_02650 HKOGLL_02650 88.5 Morganella morganii S5 - Phosphatidylethanolamine N-methyltransferase
PMI_RS15525 PMI_RS15525 58.8 Proteus mirabilis HI4320 - rRNA adenine N-6-methyltransferase family protein

Distribution of the homologs in the orthogroup group_502

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_502

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
L0D9B6 1.06e-12 66 27 4 173 1 olsG Ornithine lipid N-methyltransferase Singulisphaera acidiphila (strain ATCC BAA-1392 / DSM 18658 / VKM B-2454 / MOB10)
O05952 5.92e-05 45 32 6 108 3 rsmA Ribosomal RNA small subunit methyltransferase A Rickettsia prowazekii (strain Madrid E)
Q4UMV1 0.00018 44 35 6 108 3 rsmA Ribosomal RNA small subunit methyltransferase A Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A8GPG7 0.000221 44 34 6 108 3 rsmA Ribosomal RNA small subunit methyltransferase A Rickettsia akari (strain Hartford)
A8EZN3 0.00046 43 33 6 108 3 rsmA Ribosomal RNA small subunit methyltransferase A Rickettsia canadensis (strain McKiel)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07045
Feature type CDS
Gene -
Product rRNA adenine N-6-methyltransferase family protein
Location 1462897 - 1463472 (strand: 1)
Length 576 (nucleotides) / 191 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_502
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00398 Ribosomal RNA adenine dimethylase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3963 Lipid transport and metabolism (I) I Phosphatidylethanolamine N-methyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00570 phosphatidylethanolamine/phosphatidyl-N-methylethanolamine N-methyltransferase [EC:2.1.1.17 2.1.1.71] Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites		 Phosphatidylcholine (PC) biosynthesis, PE => PC

Protein Sequence

MEVSDYSPLRSYYAYIRKFIVSPATMGTIAPSSRWLCRAMVRHVNWADTQNFAELGAGTGVITRQILEQMSPQANLDAYEIDPYFVSLLNKFQDDRLGIFSDSAEKLSRPYNVIFSGLPFLSIDRRTGLRILKAVRDNIEVSDGQFILFQYTTKFEKYLHRYFHFRKERVLFNVPPAWVYICTPKKRQINH

Flanking regions ( +/- flanking 50bp)

GGGTTATGTTCTCTTGCACAGAACACCGGCAGAGCCTGTAAGGAATACCTATGGAAGTATCAGATTATTCACCGTTGCGAAGTTATTACGCGTACATCCGCAAATTTATTGTTTCACCTGCGACGATGGGGACCATTGCGCCGTCATCCCGCTGGTTGTGCCGCGCAATGGTTCGTCACGTTAACTGGGCAGACACACAGAATTTTGCTGAACTGGGTGCCGGAACCGGCGTTATCACCCGCCAGATTCTGGAACAGATGAGCCCGCAGGCAAACCTGGATGCCTATGAAATTGACCCGTATTTTGTCAGTCTGCTGAATAAATTTCAGGATGACCGGCTGGGCATTTTTTCGGATTCCGCAGAGAAACTGAGCCGCCCGTATAATGTTATTTTTTCCGGTTTGCCGTTTCTCTCAATCGATCGCCGCACCGGATTGCGTATTCTGAAAGCGGTCCGCGATAATATTGAAGTCAGTGACGGGCAGTTTATTCTGTTCCAGTACACCACTAAATTTGAGAAATACCTGCACCGCTACTTTCATTTCCGCAAAGAGCGTGTGTTATTTAATGTGCCTCCGGCGTGGGTGTATATCTGTACGCCGAAAAAACGTCAAATTAATCATTAAGTTCCCGCGATACTCCGATAACGCCGGGGTATCTCTGCCTTTCTGTCCAC