Homologs in group_526

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00585 FBDBKF_00585 90.3 Morganella morganii S1 fliE flagellar hook-basal body complex protein FliE
EHELCC_00960 EHELCC_00960 90.3 Morganella morganii S2 fliE flagellar hook-basal body complex protein FliE
NLDBIP_02500 NLDBIP_02500 90.3 Morganella morganii S4 fliE flagellar hook-basal body complex protein FliE
LHKJJB_04015 LHKJJB_04015 90.3 Morganella morganii S3 fliE flagellar hook-basal body complex protein FliE
HKOGLL_03030 HKOGLL_03030 90.3 Morganella morganii S5 fliE flagellar hook-basal body complex protein FliE
PMI_RS07955 PMI_RS07955 58.3 Proteus mirabilis HI4320 fliE flagellar hook-basal body complex protein FliE

Distribution of the homologs in the orthogroup group_526

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_526

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q2NWZ6 2.84e-31 109 51 1 107 3 fliE Flagellar hook-basal body complex protein FliE Sodalis glossinidius (strain morsitans)
Q7N5J9 4.88e-31 108 51 0 103 3 fliE Flagellar hook-basal body complex protein FliE Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B7L8U9 3.16e-30 106 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli (strain 55989 / EAEC)
Q3Z0Q1 3.48e-30 106 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Shigella sonnei (strain Ss046)
P0A8T5 3.48e-30 106 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli (strain K12)
B1X691 3.48e-30 106 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli (strain K12 / DH10B)
C4ZQL1 3.48e-30 106 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli (strain K12 / MC4100 / BW2952)
B5YRW4 3.48e-30 106 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8T6 3.48e-30 106 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli O157:H7
B7USV1 3.48e-30 106 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q322P1 4.1e-30 106 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Shigella boydii serotype 4 (strain Sb227)
B6I0Y4 4.1e-30 106 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli (strain SE11)
A8A1D9 4.1e-30 106 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli O9:H4 (strain HS)
B7M377 4.1e-30 106 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli O8 (strain IAI1)
B7MWC6 4.1e-30 106 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli O81 (strain ED1a)
Q83R35 8.54e-30 105 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Shigella flexneri
Q0T3J2 8.54e-30 105 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Shigella flexneri serotype 5b (strain 8401)
Q8FGL1 8.54e-30 105 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGQ7 8.54e-30 105 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AC86 8.54e-30 105 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli O1:K1 / APEC
B7NRE7 8.54e-30 105 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MCJ3 8.54e-30 105 54 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli O45:K1 (strain S88 / ExPEC)
C0Q287 9.74e-30 105 53 0 101 3 fliE Flagellar hook-basal body complex protein FliE Salmonella paratyphi C (strain RKS4594)
B4SW74 9.74e-30 105 53 0 101 3 fliE Flagellar hook-basal body complex protein FliE Salmonella newport (strain SL254)
Q57N33 9.74e-30 105 53 0 101 3 fliE Flagellar hook-basal body complex protein FliE Salmonella choleraesuis (strain SC-B67)
A9MML1 1.13e-29 105 53 0 101 3 fliE Flagellar hook-basal body complex protein FliE Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B4TZJ7 2.61e-29 103 53 0 101 3 fliE Flagellar hook-basal body complex protein FliE Salmonella schwarzengrund (strain CVM19633)
B5BGA1 2.61e-29 103 53 0 101 3 fliE Flagellar hook-basal body complex protein FliE Salmonella paratyphi A (strain AKU_12601)
A9MU40 2.61e-29 103 53 0 101 3 fliE Flagellar hook-basal body complex protein FliE Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PHZ3 2.61e-29 103 53 0 101 3 fliE Flagellar hook-basal body complex protein FliE Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5R7G4 2.61e-29 103 53 0 101 3 fliE Flagellar hook-basal body complex protein FliE Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0Z0 2.61e-29 103 53 0 101 3 fliE Flagellar hook-basal body complex protein FliE Salmonella enteritidis PT4 (strain P125109)
B5FRW4 2.61e-29 103 53 0 101 3 fliE Flagellar hook-basal body complex protein FliE Salmonella dublin (strain CT_02021853)
B5F2S0 2.61e-29 103 53 0 101 3 fliE Flagellar hook-basal body complex protein FliE Salmonella agona (strain SL483)
P26462 2.66e-29 103 53 0 101 1 fliE Flagellar hook-basal body complex protein FliE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4T8S2 2.66e-29 103 53 0 101 3 fliE Flagellar hook-basal body complex protein FliE Salmonella heidelberg (strain SL476)
A8GG07 3.58e-29 103 50 1 104 3 fliE Flagellar hook-basal body complex protein FliE Serratia proteamaculans (strain 568)
A7ZN60 7.37e-29 103 53 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LTC6 1.33e-28 102 53 0 101 3 fliE Flagellar hook-basal body complex protein FliE Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
C6D978 2.15e-28 101 50 2 105 3 fliE Flagellar hook-basal body complex protein FliE Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A4WBW7 2.68e-28 101 52 2 107 3 fliE Flagellar hook-basal body complex protein FliE Enterobacter sp. (strain 638)
Q6D6F8 2.74e-28 101 50 2 105 3 fliE Flagellar hook-basal body complex protein FliE Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8Z5S1 3.97e-28 101 52 0 101 3 fliE Flagellar hook-basal body complex protein FliE Salmonella typhi
P95713 5.76e-28 100 52 0 101 3 fliE Flagellar hook-basal body complex protein FliE Shigella boydii
Q8ZF85 2.48e-27 99 49 0 103 3 fliE Flagellar hook-basal body complex protein FliE Yersinia pestis
A1JSU2 4.28e-27 98 48 0 103 3 fliE Flagellar hook-basal body complex protein FliE Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A7MJJ7 5.89e-26 95 49 0 103 3 fliE Flagellar hook-basal body complex protein FliE Cronobacter sakazakii (strain ATCC BAA-894)
B2VDN8 4.45e-25 93 45 0 103 3 fliE Flagellar hook-basal body complex protein FliE Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C5BAA9 5.96e-23 88 46 2 105 3 fliE Flagellar hook-basal body complex protein FliE Edwardsiella ictaluri (strain 93-146)
Q46QZ0 1.25e-19 79 44 1 105 3 fliE Flagellar hook-basal body complex protein FliE Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q82T49 1.36e-19 79 42 1 104 3 fliE Flagellar hook-basal body complex protein FliE Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q3KG28 8.38e-19 77 51 0 78 3 fliE Flagellar hook-basal body complex protein FliE Pseudomonas fluorescens (strain Pf0-1)
Q9EYT4 8.38e-19 77 51 0 78 3 fliE Flagellar hook-basal body complex protein FliE Pseudomonas fluorescens
Q4KG70 2.06e-18 76 52 0 76 3 fliE Flagellar hook-basal body complex protein FliE Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q0AI14 4.19e-18 75 43 1 100 3 fliE Flagellar hook-basal body complex protein FliE Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q2L182 5.95e-17 73 39 3 114 3 fliE Flagellar hook-basal body complex protein FliE Bordetella avium (strain 197N)
A4JIN6 2.68e-16 71 46 0 71 3 fliE Flagellar hook-basal body complex protein FliE Burkholderia vietnamiensis (strain G4 / LMG 22486)
C3K0U6 2.91e-16 71 48 0 78 3 fliE Flagellar hook-basal body complex protein FliE Pseudomonas fluorescens (strain SBW25)
A9ABS7 3.05e-16 71 46 0 71 3 fliE Flagellar hook-basal body complex protein FliE Burkholderia multivorans (strain ATCC 17616 / 249)
Q48GE1 3.73e-16 70 52 0 71 3 fliE Flagellar hook-basal body complex protein FliE Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q884X9 7.16e-16 70 50 0 71 3 fliE Flagellar hook-basal body complex protein FliE Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8KA46 1.05e-15 69 39 0 71 3 fliE Flagellar hook-basal body complex protein FliE Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q8XSS8 1.75e-15 69 43 0 73 3 fliE Flagellar hook-basal body complex protein FliE Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P57174 2.35e-15 68 40 0 72 3 fliE Flagellar hook-basal body complex protein FliE Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8VQP8 2.42e-15 68 43 0 71 3 fliE Flagellar hook-basal body complex protein FliE Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q1I749 2.61e-15 68 49 0 71 3 fliE Flagellar hook-basal body complex protein FliE Pseudomonas entomophila (strain L48)
Q88ET3 3.07e-15 68 49 0 71 3 fliE Flagellar hook-basal body complex protein FliE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KQZ5 3.07e-15 68 49 0 71 3 fliE Flagellar hook-basal body complex protein FliE Pseudomonas putida (strain GB-1)
A5W0J4 3.07e-15 68 49 0 71 3 fliE Flagellar hook-basal body complex protein FliE Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A9IKU8 3.35e-15 68 35 3 111 3 fliE Flagellar hook-basal body complex protein FliE Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B1JC95 3.54e-15 68 49 0 71 3 fliE Flagellar hook-basal body complex protein FliE Pseudomonas putida (strain W619)
A3NQ97 3.77e-15 68 49 0 65 3 fliE Flagellar hook-basal body complex protein FliE Burkholderia pseudomallei (strain 1106a)
A1V7N8 3.77e-15 68 49 0 65 3 fliE Flagellar hook-basal body complex protein FliE Burkholderia mallei (strain SAVP1)
Q62EX3 3.77e-15 68 49 0 65 3 fliE Flagellar hook-basal body complex protein FliE Burkholderia mallei (strain ATCC 23344)
A2S836 3.77e-15 68 49 0 65 3 fliE Flagellar hook-basal body complex protein FliE Burkholderia mallei (strain NCTC 10229)
A3MRM9 3.77e-15 68 49 0 65 3 fliE Flagellar hook-basal body complex protein FliE Burkholderia mallei (strain NCTC 10247)
Q51462 3.89e-15 68 45 1 86 3 fliE Flagellar hook-basal body complex protein FliE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7UX89 3.89e-15 68 45 1 86 3 fliE Flagellar hook-basal body complex protein FliE Pseudomonas aeruginosa (strain LESB58)
Q02IR7 6.2e-15 67 48 0 72 3 fliE Flagellar hook-basal body complex protein FliE Pseudomonas aeruginosa (strain UCBPP-PA14)
A4VMP0 6.41e-15 67 44 1 86 3 fliE Flagellar hook-basal body complex protein FliE Stutzerimonas stutzeri (strain A1501)
Q39C10 7.01e-15 67 47 0 65 3 fliE Flagellar hook-basal body complex protein FliE Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A6V990 1.07e-14 67 49 0 71 3 fliE Flagellar hook-basal body complex protein FliE Pseudomonas aeruginosa (strain PA7)
B3PEY6 6.29e-14 65 40 0 71 3 fliE Flagellar hook-basal body complex protein FliE Cellvibrio japonicus (strain Ueda107)
C5BSE0 1.36e-13 64 39 1 87 3 fliE Flagellar hook-basal body complex protein FliE Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q31FN8 8.05e-13 62 42 3 99 3 fliE Flagellar hook-basal body complex protein FliE Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q8EQY4 1.13e-12 61 42 3 95 3 fliE Flagellar hook-basal body complex protein FliE Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9KA31 2.49e-12 60 39 1 91 3 fliE Flagellar hook-basal body complex protein FliE Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q89B01 4.6e-12 60 35 0 80 3 fliE Flagellar hook-basal body complex protein FliE Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q21IN0 4.89e-12 60 38 0 76 3 fliE Flagellar hook-basal body complex protein FliE Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
P24502 3.93e-10 55 42 1 71 3 fliE Flagellar hook-basal body complex protein FliE Bacillus subtilis (strain 168)
A1U260 1.01e-09 54 34 0 72 3 fliE Flagellar hook-basal body complex protein FliE Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q9X186 3.62e-09 52 30 1 71 3 fliE Flagellar hook-basal body complex protein FliE Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O67242 1.35e-08 51 35 1 76 3 fliE Flagellar hook-basal body complex protein FliE Aquifex aeolicus (strain VF5)
Q97H50 1.39e-08 51 37 2 80 3 fliE Flagellar hook-basal body complex protein FliE Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B3EBH2 3.56e-06 45 37 3 78 3 fliE Flagellar hook-basal body complex protein FliE Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q9A9M3 5.35e-06 44 36 1 75 3 fliE Flagellar hook-basal body complex protein FliE Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A1SEQ0 9.26e-06 43 27 4 110 3 fliE Flagellar hook-basal body complex protein FliE Nocardioides sp. (strain ATCC BAA-499 / JS614)
P67707 1.25e-05 43 32 2 83 3 fliE Flagellar hook-basal body complex protein FliE Brucella suis biovar 1 (strain 1330)
A9WXL2 1.25e-05 43 32 2 83 3 fliE Flagellar hook-basal body complex protein FliE Brucella suis (strain ATCC 23445 / NCTC 10510)
P67706 1.25e-05 43 32 2 83 3 fliE Flagellar hook-basal body complex protein FliE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RK96 1.25e-05 43 32 2 83 3 fliE Flagellar hook-basal body complex protein FliE Brucella melitensis biotype 2 (strain ATCC 23457)
A9MDR2 1.25e-05 43 32 2 83 3 fliE Flagellar hook-basal body complex protein FliE Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q579U0 1.25e-05 43 32 2 83 3 fliE Flagellar hook-basal body complex protein FliE Brucella abortus biovar 1 (strain 9-941)
Q2YJ71 1.25e-05 43 32 2 83 3 fliE Flagellar hook-basal body complex protein FliE Brucella abortus (strain 2308)
B2SCV8 1.25e-05 43 32 2 83 3 fliE Flagellar hook-basal body complex protein FliE Brucella abortus (strain S19)
A6X6Q6 1.26e-05 43 32 2 83 3 fliE Flagellar hook-basal body complex protein FliE Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A5VTQ7 6.45e-05 42 32 2 83 3 fliE Flagellar hook-basal body complex protein FliE Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
B8FTR7 7.3e-05 42 30 2 96 3 fliE Flagellar hook-basal body complex protein FliE Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q24T63 0.000121 41 31 1 72 3 fliE Flagellar hook-basal body complex protein FliE Desulfitobacterium hafniense (strain Y51)
P67708 0.000288 40 26 1 90 3 fliE Flagellar hook-basal body complex protein FliE Helicobacter pylori (strain ATCC 700392 / 26695)
B2UVX4 0.000288 40 26 1 90 3 fliE Flagellar hook-basal body complex protein FliE Helicobacter pylori (strain Shi470)
P67709 0.000288 40 26 1 90 3 fliE Flagellar hook-basal body complex protein FliE Helicobacter pylori (strain J99 / ATCC 700824)
Q1CR49 0.000288 40 26 1 90 3 fliE Flagellar hook-basal body complex protein FliE Helicobacter pylori (strain HPAG1)
B6JP67 0.000288 40 26 1 90 3 fliE Flagellar hook-basal body complex protein FliE Helicobacter pylori (strain P12)
B5Z9I8 0.000654 39 28 1 75 3 fliE Flagellar hook-basal body complex protein FliE Helicobacter pylori (strain G27)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06595
Feature type CDS
Gene fliE
Product flagellar hook-basal body complex protein FliE
Location 1373480 - 1373791 (strand: -1)
Length 312 (nucleotides) / 103 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_526
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02049 Flagellar hook-basal body complex protein FliE

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1677 Cell motility (N) N Flagellar hook-basal body complex protein FliE

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02408 flagellar hook-basal body complex protein FliE Flagellar assembly -

Protein Sequence

MTIQAIEGVVSQLNVTAAQVANQTKPVVEGVGFGDHLVSAVNQINTTRVESAKKTEDFTLGKADVSLNDVMVDMQKASLSLQMGIQVRNKLVAAYQEIMSMPV

Flanking regions ( +/- flanking 50bp)

AAAAAGCGCGCTGTGAAATTCAATAACCCGTAATAACAGAAGAGAAAAACATGACGATTCAGGCAATTGAAGGGGTTGTTTCCCAACTGAATGTAACGGCAGCACAGGTCGCAAACCAAACCAAACCTGTGGTTGAGGGTGTGGGCTTCGGTGATCATCTGGTTTCAGCCGTTAATCAGATTAATACCACGCGGGTAGAGTCTGCGAAGAAAACGGAAGACTTTACCCTGGGTAAAGCCGATGTTTCACTCAATGATGTTATGGTGGACATGCAAAAAGCCAGCCTGAGCCTGCAAATGGGTATTCAGGTGCGTAACAAGCTGGTTGCTGCATACCAGGAGATTATGTCAATGCCGGTGTGATGTGGTTATCTGATTGATAATTAACACTAAATGTCAACATCAAAACTAGC