Homologs in group_4002

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4002

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4002

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64495 2.49e-19 77 58 2 68 4 yoaF Uncharacterized protein YoaF Shigella flexneri
P64493 2.49e-19 77 58 2 68 4 yoaF Uncharacterized protein YoaF Escherichia coli (strain K12)
P64494 2.49e-19 77 58 2 68 4 yoaF Uncharacterized protein YoaF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O28332 3.11e-05 43 40 0 44 3 AF_1947 Uncharacterized protein AF_1947 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06575
Feature type CDS
Gene -
Product DUF333 domain-containing protein
Location 1371273 - 1371500 (strand: 1)
Length 228 (nucleotides) / 75 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_4002
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF03891 Domain of unknown function (DUF333)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3042 General function prediction only (R) R Putative hemolysin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09712 uncharacterized protein - -

Protein Sequence

MKKVILLITAGVIAGCSSAPQSSQKIGMANPASVYCEQSGGTLKIKDTADGQVGYCTLPDGSEIEEWALYRRDHK

Flanking regions ( +/- flanking 50bp)

GATATGAATTGTTAACCGTACTGGATAAAGACAGGAAATAAATACATCCGATGAAAAAAGTAATTTTACTGATAACAGCCGGTGTTATTGCCGGTTGTTCATCCGCCCCGCAAAGTTCGCAAAAAATAGGAATGGCAAACCCGGCATCCGTATATTGTGAACAATCCGGCGGTACGCTTAAAATAAAAGATACGGCTGATGGTCAGGTTGGTTATTGTACATTACCGGACGGCAGTGAAATTGAAGAATGGGCACTGTACCGCCGTGACCATAAATAAAAAGAGTGGAATATAGGCAGGGGTGATAAATTATCACCCCTGCTCTGTAT