Homologs in group_4829
0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product |
|---|
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| P33229 | 1.48e-05 | 41 | 33 | 2 | 56 | 1 | ralR | Endodeoxyribonuclease toxin RalR | Escherichia coli (strain K12) |
| Source | Morganella psychrotolerans |
|---|---|
| Locus tag | F4V73_RS06210 |
| Feature type | CDS |
| Gene | - |
| Product | Lar family restriction alleviation protein |
| Location | 1303684 - 1303875 (strand: -1) |
| Length | 192 (nucleotides) / 63 (amino acids) |
| In genomic island | GI68 |
| Accession | NZ_VXKB01000001 |
|---|---|
| Length | 2012992 nucleotides |
| Topology | linear |
| Plasmid | False |
| Orthogroup | group_4829 | |
|---|---|---|
| Orthogroup size | 1 | |
| N. genomes | 1 |
MTEKTQKLKPCPFCGCADITIHKPTYQDMTLFSIACDGCDVRIKRFNEPEAISAWNRRAPTGG
GCTGCCATATCAGACACCGGCACTACCACAACCACCGGAGGAGTGATGAAATGACAGAGAAAACACAGAAGCTAAAGCCATGCCCGTTTTGCGGATGCGCGGACATCACAATTCACAAGCCGACATATCAGGATATGACTCTGTTCAGTATTGCCTGTGACGGCTGCGATGTACGGATTAAGCGCTTTAACGAGCCGGAGGCAATTTCAGCCTGGAACCGGAGAGCACCAACAGGGGGTTAAATGCAAAAACAGACATTCCTACTCAGGAATGCGCGAATACTCAGCAATCT
