Homologs in group_123

Help

10 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11360 FBDBKF_11360 63.2 Morganella morganii S1 - DUF2570 domain-containing protein
FBDBKF_19895 FBDBKF_19895 46.4 Morganella morganii S1 - DUF2570 domain-containing protein
EHELCC_07720 EHELCC_07720 46.4 Morganella morganii S2 - DUF2570 domain-containing protein
EHELCC_17855 EHELCC_17855 63.2 Morganella morganii S2 - DUF2570 domain-containing protein
NLDBIP_05185 NLDBIP_05185 63.2 Morganella morganii S4 - DUF2570 domain-containing protein
NLDBIP_08045 NLDBIP_08045 46.4 Morganella morganii S4 - DUF2570 domain-containing protein
LHKJJB_02065 LHKJJB_02065 63.2 Morganella morganii S3 - DUF2570 domain-containing protein
LHKJJB_06220 LHKJJB_06220 46.4 Morganella morganii S3 - DUF2570 domain-containing protein
HKOGLL_15445 HKOGLL_15445 63.2 Morganella morganii S5 - DUF2570 domain-containing protein
HKOGLL_19075 HKOGLL_19075 46.4 Morganella morganii S5 - DUF2570 domain-containing protein

Distribution of the homologs in the orthogroup group_123

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_123

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06165
Feature type CDS
Gene -
Product hypothetical protein
Location 1299677 - 1300054 (strand: -1)
Length 378 (nucleotides) / 125 (amino acids)
In genomic island GI68

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_123
Orthogroup size 11
N. genomes 6

Actions

Genomic region

Protein Sequence

MSTATKIWLGICGTLAIGLLLMLHLYGGLKDNYQLLSEKHSRLTTVNNITIAAVAVNHRVSLDNINAKQVEGTEHVKVKTVIKTVFKDSECAAIPVPADAVSELQKYAAGIRARASGFDTAKPDR

Flanking regions ( +/- flanking 50bp)

TTGCCGATTGAGACACGGTTCATTGATGCGCCTCATATCGAAATACCGGCATGAGTACCGCGACAAAGATATGGCTCGGTATTTGCGGAACACTGGCTATCGGCTTGCTGCTGATGCTACACCTGTACGGCGGGCTGAAAGATAATTATCAGCTGTTGTCTGAAAAACACAGTCGCCTGACCACTGTTAATAACATCACCATAGCGGCAGTCGCAGTCAATCACCGCGTATCACTCGACAACATCAACGCCAAACAGGTAGAGGGTACTGAGCATGTCAAAGTTAAGACTGTTATCAAAACGGTTTTCAAAGACAGCGAATGCGCTGCTATTCCTGTGCCCGCTGATGCTGTTAGTGAGTTGCAAAAGTACGCCGCCGGAATACGTGCCCGCGCCAGTGGTTTCGATACCGCCAAACCTGACCGCTGATTGCGAACAGATAGTTATACCGGATGATCTGACGTTCGGTGGCGCTGTTG