Homologs in group_959

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05260 FBDBKF_05260 81.9 Morganella morganii S1 yciU HI1450 family dsDNA-mimic protein
EHELCC_12330 EHELCC_12330 81.9 Morganella morganii S2 yciU HI1450 family dsDNA-mimic protein
NLDBIP_12670 NLDBIP_12670 81.9 Morganella morganii S4 yciU HI1450 family dsDNA-mimic protein
LHKJJB_12530 LHKJJB_12530 81.9 Morganella morganii S3 yciU HI1450 family dsDNA-mimic protein
HKOGLL_11145 HKOGLL_11145 81.9 Morganella morganii S5 yciU HI1450 family dsDNA-mimic protein
PMI_RS06555 PMI_RS06555 55.0 Proteus mirabilis HI4320 - HI1450 family dsDNA-mimic protein

Distribution of the homologs in the orthogroup group_959

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_959

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A4WB85 7.92e-31 108 55 1 110 3 Ent638_2296 UPF0263 protein Ent638_2296 Enterobacter sp. (strain 638)
B7LS30 1.18e-29 105 53 1 110 3 yciU UPF0263 protein YciU Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B2TZZ3 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LH52 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli (strain SMS-3-5 / SECEC)
B6I9W1 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli (strain SE11)
B7N459 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8L7 2.62e-29 104 52 1 110 1 yciU UPF0263 protein YciU Escherichia coli (strain K12)
B1ITK8 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8L8 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIC3 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZZI4 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli O9:H4 (strain HS)
B1XAT8 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli (strain K12 / DH10B)
C4ZTU0 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli (strain K12 / MC4100 / BW2952)
B7LY03 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli O8 (strain IAI1)
B7MU35 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli O81 (strain ED1a)
B7NVL7 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YYF3 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8L9 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli O157:H7
B7LHJ3 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli (strain 55989 / EAEC)
B7UQD8 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZL19 2.62e-29 104 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AG49 2.68e-29 104 52 1 110 3 CKO_01325 UPF0263 protein CKO_01325 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8Z7E5 3.15e-29 104 52 1 110 3 yciU UPF0263 protein YciU Salmonella typhi
B5BIA7 3.15e-29 104 52 1 110 3 yciU UPF0263 protein YciU Salmonella paratyphi A (strain AKU_12601)
Q5PNL2 3.15e-29 104 52 1 110 3 yciU UPF0263 protein YciU Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57NR9 3.15e-29 104 52 1 110 3 yciU UPF0263 protein YciU Salmonella choleraesuis (strain SC-B67)
Q8ZP48 4.57e-29 103 52 1 110 3 yciU UPF0263 protein YciU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9MWP8 4.57e-29 103 52 1 110 3 yciU UPF0263 protein YciU Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
A9MPD4 5.39e-29 103 51 1 110 3 yciU UPF0263 protein YciU Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7ML00 5.69e-29 103 52 1 110 3 yciU UPF0263 protein YciU Escherichia coli O45:K1 (strain S88 / ExPEC)
Q8ZEI3 2.11e-28 102 60 0 91 3 YPO2187 UPF0263 protein YPO2187/y2032/YP_1985 Yersinia pestis
A9R8K9 2.11e-28 102 60 0 91 3 YpAngola_A2157 UPF0263 protein YpAngola_A2157 Yersinia pestis bv. Antiqua (strain Angola)
Q66AM0 2.11e-28 102 60 0 91 3 YPTB2110 UPF0263 protein YPTB2110 Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FI51 2.11e-28 102 60 0 91 3 YpsIP31758_1954 UPF0263 protein YpsIP31758_1954 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JQ46 2.22e-28 102 59 0 91 3 YE2228 UPF0263 protein YE2228 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q83LD1 2.28e-28 102 51 1 110 3 yciU UPF0263 protein YciU Shigella flexneri
A8GFA1 3.3e-28 101 60 0 91 3 Spro_2690 UPF0263 protein Spro_2690 Serratia proteamaculans (strain 568)
A6TAJ8 4.49e-28 101 51 1 110 3 KPN78578_21580 UPF0263 protein KPN78578_21580 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XQA8 4.49e-28 101 51 1 110 3 KPK_2119 UPF0263 protein KPK_2119 Klebsiella pneumoniae (strain 342)
Q7N466 1.94e-27 99 49 1 104 3 plu2488 UPF0263 protein plu2488 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DGY2 7.18e-27 98 57 0 91 3 PC1_1990 UPF0263 protein PC1_1990 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D4S1 9.85e-27 98 57 0 91 3 ECA2319 UPF0263 protein ECA2319 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2VKV3 2.55e-26 97 57 0 91 3 ETA_15890 UPF0263 protein ETA_15890 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7MNA3 1.86e-25 94 48 1 110 3 ESA_01547 UPF0263 protein ESA_01547 Cronobacter sakazakii (strain ATCC BAA-894)
A5UEW7 1.15e-23 90 43 2 108 3 CGSHiGG_01135 UPF0263 protein CGSHiGG_01135 Haemophilus influenzae (strain PittGG)
Q0I370 2e-23 89 42 2 108 3 HS_0995 UPF0263 protein HS_0995 Histophilus somni (strain 129Pt)
Q87NB9 2.86e-23 89 52 0 88 3 VP1949 UPF0263 protein VP1949 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P44199 3.07e-23 89 43 2 108 1 HI_1450 UPF0263 protein HI_1450 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A7MRY9 4.01e-23 89 52 0 88 3 VIBHAR_02752 UPF0263 protein VIBHAR_02752 Vibrio campbellii (strain ATCC BAA-1116)
B0UUJ4 4.96e-23 88 42 2 108 3 HSM_1473 UPF0263 protein HSM_1473 Histophilus somni (strain 2336)
A5F1Y1 7.61e-22 85 50 0 88 3 VC0395_A0828 UPF0263 protein VC0395_A0828/VC395_1327 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KSP8 7.61e-22 85 50 0 88 3 VC_1208 UPF0263 protein VC_1208 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LLQ4 7.61e-22 85 50 0 88 3 VCM66_1163 UPF0263 protein VCM66_1163 Vibrio cholerae serotype O1 (strain M66-2)
Q4QKH7 8.34e-22 85 42 2 108 3 NTHI1680 UPF0263 protein NTHI1680 Haemophilus influenzae (strain 86-028NP)
B8F5L9 2.99e-21 84 45 2 103 3 HAPS_1002 UPF0263 protein HAPS_1002 Glaesserella parasuis serovar 5 (strain SH0165)
B3GYC8 4.47e-21 83 45 5 106 3 APP7_1400 UPF0263 protein APP7_1400 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BQT7 4.47e-21 83 45 5 106 3 APJL_1366 UPF0263 protein APJL_1366 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N1Z6 4.47e-21 83 45 5 106 3 APL_1348 UPF0263 protein APL_1348 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VMJ1 5.33e-21 83 42 2 104 3 HD_0986 UPF0263 protein HD_0986 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9CN99 7.75e-21 83 46 2 97 3 PM0536 UPF0263 protein PM0536 Pasteurella multocida (strain Pm70)
Q65TT7 1.46e-20 82 40 2 108 3 MS1016 UPF0263 protein MS1016 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VNS2 1.72e-20 82 40 2 108 3 Asuc_1259 UPF0263 protein Asuc_1259 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q7MM45 7.14e-20 80 46 0 88 3 VV1228 UPF0263 protein VV1228 Vibrio vulnificus (strain YJ016)
Q8D8C1 1.78e-19 79 46 0 88 3 VV1_3059 UPF0263 protein VV1_3059 Vibrio vulnificus (strain CMCP6)
Q6LRZ3 2.24e-19 79 45 0 88 3 PBPRA1522 UPF0263 protein PBPRA1522 Photobacterium profundum (strain SS9)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05715
Feature type CDS
Gene -
Product HI1450 family dsDNA-mimic protein
Location 1214947 - 1215279 (strand: 1)
Length 333 (nucleotides) / 110 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_959
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04269 Protein of unknown function, DUF440

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3099 Function unknown (S) S Uncharacterized conserved protein YciU, UPF0263 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09901 uncharacterized protein - -

Protein Sequence

MSTPRPRRLSEQETIEMAYDLFLEQAMDNLDPADVLLFNLQFEDCGGAELVPTGNDWSEIASFPAQTPDCAEVVIGLAPDDDADIDQIFARVLLSRQFTGTPEFAIRWRK

Flanking regions ( +/- flanking 50bp)

TATCCCTGCAACTGCCCTGTTGCAGGGAATAACCGGAAAGCTGTCTGACCATGAGCACCCCACGTCCCCGCCGCCTCAGCGAGCAAGAAACCATTGAAATGGCATACGATCTGTTTTTGGAACAGGCAATGGATAATCTGGATCCCGCCGATGTCCTGTTATTTAATCTGCAATTTGAAGATTGCGGAGGTGCGGAACTGGTACCCACCGGTAATGACTGGTCTGAAATCGCCTCTTTTCCGGCACAAACTCCGGACTGCGCAGAAGTGGTTATCGGGCTGGCACCGGACGATGATGCCGATATCGACCAGATTTTCGCCCGTGTTCTCCTCTCACGCCAATTTACCGGCACCCCGGAATTTGCTATTCGCTGGCGGAAATAATCTGTCTTTTTTGTTTCCCGGTCGTGTGCGGGGTTCGCACCCCGCTCATA