Homologs in group_754

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02625 FBDBKF_02625 86.4 Morganella morganii S1 yaiI YaiI/YqxD family protein
EHELCC_03095 EHELCC_03095 86.4 Morganella morganii S2 yaiI YaiI/YqxD family protein
NLDBIP_00365 NLDBIP_00365 86.4 Morganella morganii S4 yaiI YaiI/YqxD family protein
LHKJJB_01670 LHKJJB_01670 86.4 Morganella morganii S3 yaiI YaiI/YqxD family protein
HKOGLL_01710 HKOGLL_01710 86.4 Morganella morganii S5 yaiI YaiI/YqxD family protein
PMI_RS06075 PMI_RS06075 80.8 Proteus mirabilis HI4320 - YaiI/YqxD family protein

Distribution of the homologs in the orthogroup group_754

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_754

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F2U6 3.19e-90 261 81 0 150 3 PMI1258 UPF0178 protein PMI1258 Proteus mirabilis (strain HI4320)
B2VIT2 1.33e-86 253 81 0 149 3 ETA_25650 UPF0178 protein ETA_25650 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6D8U9 1.31e-81 240 75 0 149 3 ECA0873 UPF0178 protein ECA0873 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JL36 2.71e-81 239 76 0 149 3 YE1167 UPF0178 protein YE1167 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6D9M4 8.67e-81 238 75 0 149 3 PC1_0756 UPF0178 protein PC1_0756 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q8ZCF8 1e-80 238 74 0 150 3 YPO3033 UPF0178 protein YPO3033/y1450/YP_2656 Yersinia pestis
B2K963 1e-80 238 74 0 150 3 YPTS_2857 UPF0178 protein YPTS_2857 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A9QZK7 1e-80 238 74 0 150 3 YpAngola_A2785 UPF0178 protein YpAngola_A2785 Yersinia pestis bv. Antiqua (strain Angola)
Q668I5 1e-80 238 74 0 150 3 YPTB2755 UPF0178 protein YPTB2755 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1C5T6 1e-80 238 74 0 150 3 YPA_2221 UPF0178 protein YPA_2221 Yersinia pestis bv. Antiqua (strain Antiqua)
A4TMK3 1e-80 238 74 0 150 3 YPDSF_2138 UPF0178 protein YPDSF_2138 Yersinia pestis (strain Pestoides F)
B1JSJ5 1e-80 238 74 0 150 3 YPK_1392 UPF0178 protein YPK_1392 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q1CJZ8 1e-80 238 74 0 150 3 YPN_1352 UPF0178 protein YPN_1352 Yersinia pestis bv. Antiqua (strain Nepal516)
A7FG81 1e-80 238 74 0 150 3 YpsIP31758_1279 UPF0178 protein YpsIP31758_1279 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4W762 1.32e-79 235 74 0 152 3 Ent638_0858 UPF0178 protein Ent638_0858 Enterobacter sp. (strain 638)
B5Y115 7.85e-78 230 75 0 150 3 KPK_4355 UPF0178 protein KPK_4355 Klebsiella pneumoniae (strain 342)
P67334 7.94e-78 230 76 1 151 3 yaiI UPF0178 protein YaiI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67335 7.94e-78 230 76 1 151 3 yaiI UPF0178 protein YaiI Salmonella typhi
B4TZG0 7.94e-78 230 76 1 151 3 yaiI UPF0178 protein YaiI Salmonella schwarzengrund (strain CVM19633)
B5BDE6 7.94e-78 230 76 1 151 3 yaiI UPF0178 protein YaiI Salmonella paratyphi A (strain AKU_12601)
Q5PFV4 7.94e-78 230 76 1 151 3 yaiI UPF0178 protein YaiI Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SW27 7.94e-78 230 76 1 151 3 yaiI UPF0178 protein YaiI Salmonella newport (strain SL254)
B4T8M6 7.94e-78 230 76 1 151 3 yaiI UPF0178 protein YaiI Salmonella heidelberg (strain SL476)
B5FKP2 7.94e-78 230 76 1 151 3 yaiI UPF0178 protein YaiI Salmonella dublin (strain CT_02021853)
B5EWR9 7.94e-78 230 76 1 151 3 yaiI UPF0178 protein YaiI Salmonella agona (strain SL483)
A9MX51 1.16e-77 230 76 1 151 3 yaiI UPF0178 protein YaiI Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
A9MMS3 2.38e-77 229 75 1 151 3 yaiI UPF0178 protein YaiI Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6T5B1 3.06e-77 229 74 0 150 3 KPN78578_03210 UPF0178 protein KPN78578_03210 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5QTD6 4.84e-77 228 75 1 151 3 yaiI UPF0178 protein YaiI Salmonella enteritidis PT4 (strain P125109)
A7MLV7 6.51e-77 228 72 0 150 3 ESA_02916 UPF0178 protein ESA_02916 Cronobacter sakazakii (strain ATCC BAA-894)
C0Q7R0 1.26e-76 227 75 1 151 3 yaiI UPF0178 protein YaiI Salmonella paratyphi C (strain RKS4594)
A8AK77 1.95e-76 227 71 0 150 3 CKO_02784 UPF0178 protein CKO_02784 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q57SH7 7.42e-76 225 74 1 151 3 yaiI UPF0178 protein YaiI Salmonella choleraesuis (strain SC-B67)
B7LMJ8 1.4e-75 225 72 0 150 3 yaiI UPF0178 protein YaiI Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B2U3Y9 1.16e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7UJL1 1.5e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7N8T9 1.63e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q3Z523 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Shigella sonnei (strain Ss046)
Q32JD6 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Shigella dysenteriae serotype 1 (strain Sd197)
Q325L1 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Shigella boydii serotype 4 (strain Sb227)
B1LIS1 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli (strain SMS-3-5 / SECEC)
B6HZI7 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli (strain SE11)
P0A8D3 2.12e-74 222 71 0 149 1 yaiI UPF0178 protein YaiI Escherichia coli (strain K12)
P0A8D4 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKQ4 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A859 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli O1:K1 / APEC
A7ZX37 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli O9:H4 (strain HS)
B1XEX6 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli (strain K12 / DH10B)
C4ZTE6 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli (strain K12 / MC4100 / BW2952)
B7M332 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli O8 (strain IAI1)
B5Z2T9 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8D5 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli O157:H7
B7L542 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli (strain 55989 / EAEC)
B7MD46 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZID6 2.12e-74 222 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli O139:H28 (strain E24377A / ETEC)
B7MPE8 2.27e-74 222 72 0 146 3 yaiI UPF0178 protein YaiI Escherichia coli O81 (strain ED1a)
B7NJB5 2.7e-74 221 71 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B1J061 5.51e-74 221 70 0 149 3 yaiI UPF0178 protein YaiI Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q83M67 2.95e-73 219 70 0 149 3 yaiI UPF0178 protein YaiI Shigella flexneri
Q2NS87 5.43e-71 213 68 0 150 3 SG1713 UPF0178 protein SG1713 Sodalis glossinidius (strain morsitans)
A1WYB5 1.05e-69 210 68 0 150 3 Hhal_1913 UPF0178 protein Hhal_1913 Halorhodospira halophila (strain DSM 244 / SL1)
Q47Y68 1.1e-69 210 63 0 149 3 CPS_3584 UPF0178 protein CPS_3584 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1SBK3 5.29e-69 208 63 0 149 3 Sama_3557 UPF0178 protein Sama_3557 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q5NYY1 1.43e-68 207 70 0 144 3 AZOSEA36080 UPF0178 protein AZOSEA36080 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B8GM72 1.51e-68 207 65 0 147 3 Tgr7_2584 UPF0178 protein Tgr7_2584 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A8FSY8 1.12e-66 202 61 0 149 3 Ssed_1350 UPF0178 protein Ssed_1350 Shewanella sediminis (strain HAW-EB3)
B1KJR3 1.13e-66 202 61 0 149 3 Swoo_1444 UPF0178 protein Swoo_1444 Shewanella woodyi (strain ATCC 51908 / MS32)
Q9KTM1 3.87e-66 201 63 0 147 3 VC_0881 UPF0178 protein VC_0881 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LTD1 3.87e-66 201 63 0 147 3 VCM66_0838 UPF0178 protein VCM66_0838 Vibrio cholerae serotype O1 (strain M66-2)
A5F345 3.87e-66 201 63 0 147 3 VC0395_A0405 UPF0178 protein VC0395_A0405/VC395_0897 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A4G1V0 6.13e-66 200 63 0 149 3 HEAR0259 UPF0178 protein HEAR0259 Herminiimonas arsenicoxydans
Q2S6Z8 8.7e-66 200 64 0 149 3 HCH_06960 UPF0178 protein HCH_06960 Hahella chejuensis (strain KCTC 2396)
B6EGH0 1.07e-65 199 61 0 151 3 VSAL_I0701 UPF0178 protein VSAL_I0701 Aliivibrio salmonicida (strain LFI1238)
B8CJH9 1.59e-65 199 61 0 150 3 swp_1285 UPF0178 protein swp_1285 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q7MIF1 1.77e-65 199 61 0 147 3 VV2566 UPF0178 protein VV2566 Vibrio vulnificus (strain YJ016)
B0TPE7 2.18e-65 199 60 0 149 3 Shal_3046 UPF0178 protein Shal_3046 Shewanella halifaxensis (strain HAW-EB4)
Q0A879 4.08e-65 198 66 0 144 3 Mlg_1612 UPF0178 protein Mlg_1612 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q31E38 6.31e-65 197 62 1 150 3 Tcr_1995 UPF0178 protein Tcr_1995 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3A187 8.31e-65 197 63 0 144 3 Pcar_2632 UPF0178 protein Pcar_2632 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q8DBH0 1.71e-64 196 61 0 149 3 VV1_1847 UPF0178 protein VV1_1847 Vibrio vulnificus (strain CMCP6)
A6SUQ5 1.75e-64 196 60 0 150 3 mma_0312 UPF0178 protein mma_0312 Janthinobacterium sp. (strain Marseille)
A3QGJ4 2.18e-64 196 60 0 150 3 Shew_2726 UPF0178 protein Shew_2726 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q7NX61 2.83e-64 196 64 0 147 3 CV_1768 UPF0178 protein CV_1768 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q5E7A0 4.44e-64 196 61 0 148 3 VF_0601 UPF0178 protein VF_0601 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FAU4 5.77e-64 195 61 0 148 3 VFMJ11_0615 UPF0178 protein VFMJ11_0615 Aliivibrio fischeri (strain MJ11)
B0C2Z9 7.41e-64 195 62 0 149 3 AM1_1179 UPF0178 protein AM1_1179 Acaryochloris marina (strain MBIC 11017)
A8H6T8 7.41e-64 195 59 0 149 3 Spea_2958 UPF0178 protein Spea_2958 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A7N1X1 7.59e-64 195 61 0 147 3 VIBHAR_03247 UPF0178 protein VIBHAR_03247 Vibrio campbellii (strain ATCC BAA-1116)
Q6LRD1 1.38e-63 194 61 0 150 3 PBPRA1738 UPF0178 protein PBPRA1738 Photobacterium profundum (strain SS9)
Q87MC8 3.19e-63 193 60 0 147 3 VP2328 UPF0178 protein VP2328 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C4LC98 9.73e-63 192 59 0 149 3 Tola_2809 UPF0178 protein Tola_2809 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B7VIS8 2.34e-62 191 59 0 147 3 VS_2364 UPF0178 protein VS_2364 Vibrio atlanticus (strain LGP32)
Q47C22 3.04e-62 191 62 0 144 3 Daro_2879 UPF0178 protein Daro_2879 Dechloromonas aromatica (strain RCB)
B7JBE5 4.04e-62 191 64 0 146 3 AFE_3267 UPF0178 protein AFE_3267 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B5ERK4 4.04e-62 191 64 0 146 3 Lferr_2865 UPF0178 protein Lferr_2865 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
A0KVP1 9.07e-62 190 60 0 144 3 Shewana3_1627 UPF0178 protein Shewana3_1627 Shewanella sp. (strain ANA-3)
Q0HJX9 1.03e-61 189 60 0 144 3 Shewmr4_1560 UPF0178 protein Shewmr4_1560 Shewanella sp. (strain MR-4)
A0KFQ0 1.07e-61 189 60 0 148 3 AHA_0543 UPF0178 protein AHA_0543 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q0HW75 1.69e-61 189 59 0 147 3 Shewmr7_1635 UPF0178 protein Shewmr7_1635 Shewanella sp. (strain MR-7)
Q8ED72 3.12e-61 188 60 0 146 3 SO_2894 UPF0178 protein SO_2894 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P52089 3.76e-61 188 60 0 150 3 None UPF0178 protein in pahZ1 5'region Paucimonas lemoignei
A9KY73 1.03e-60 187 59 0 144 3 Sbal195_1808 UPF0178 protein Sbal195_1808 Shewanella baltica (strain OS195)
A4SS38 1.04e-60 187 60 0 148 3 ASA_3749 UPF0178 protein ASA_3749 Aeromonas salmonicida (strain A449)
A3D3G5 1.72e-60 186 59 0 144 3 Sbal_1771 UPF0178 protein Sbal_1771 Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q2KU14 2e-60 186 64 0 141 3 BAV3236 UPF0178 protein BAV3236 Bordetella avium (strain 197N)
B8EAH9 2.45e-60 186 59 0 144 3 Sbal223_2514 UPF0178 protein Sbal223_2514 Shewanella baltica (strain OS223)
Q3ICQ7 3.01e-60 186 59 1 149 3 PSHAb0045 UPF0178 protein PSHAb0045 Pseudoalteromonas translucida (strain TAC 125)
A6WM68 8.71e-60 185 59 0 144 3 Shew185_1764 UPF0178 protein Shew185_1764 Shewanella baltica (strain OS185)
Q21G89 1.52e-59 184 57 0 149 3 Sde_3033 UPF0178 protein Sde_3033 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A6VXK1 4.6e-59 183 59 0 149 3 Mmwyl1_2258 UPF0178 protein Mmwyl1_2258 Marinomonas sp. (strain MWYL1)
Q5QW04 5.09e-59 182 55 0 144 3 IL2341 UPF0178 protein IL2341 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A9I3Y9 7.69e-59 182 60 0 145 3 Bpet3884 UPF0178 protein Bpet3884 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B2TFJ4 3.05e-58 181 57 0 154 3 Bphyt_5655 UPF0178 protein Bphyt_5655 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
C5BRB6 4.96e-58 180 57 0 147 3 TERTU_3490 UPF0178 protein TERTU_3490 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q15W94 8.75e-58 179 56 0 147 3 Patl_1318 UPF0178 protein Patl_1318 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
C6BYX0 4.55e-57 178 52 0 151 3 Desal_2673 UPF0178 protein Desal_2673 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q6F963 2.07e-56 176 50 0 150 3 ACIAD2644 UPF0178 protein ACIAD2644 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0VDK5 6.83e-56 175 50 0 150 3 ABAYE0880 UPF0178 protein ABAYE0880 Acinetobacter baumannii (strain AYE)
B0VT55 6.83e-56 175 50 0 150 3 ABSDF0879 UPF0178 protein ABSDF0879 Acinetobacter baumannii (strain SDF)
B2HWW1 6.83e-56 175 50 0 150 3 ACICU_02858 UPF0178 protein ACICU_02858 Acinetobacter baumannii (strain ACICU)
A3M7Y8 6.83e-56 175 50 0 150 3 A1S_2615 UPF0178 protein A1S_2615 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B3PHH8 8.83e-56 174 58 1 150 3 CJA_1978 UPF0178 protein CJA_1978 Cellvibrio japonicus (strain Ueda107)
A1U2P6 1.4e-55 174 56 1 150 3 Maqu_2186 UPF0178 protein Maqu_2186 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B1YQC8 5.2e-55 172 57 0 149 3 BamMC406_1579 UPF0178 protein BamMC406_1579 Burkholderia ambifaria (strain MC40-6)
Q0BFF5 5.2e-55 172 57 0 149 3 Bamb_1560 UPF0178 protein Bamb_1560 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q7WMX3 1.57e-54 172 58 1 150 3 BB1267 UPF0178 protein BB1267 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B2SHQ8 1.58e-54 172 52 0 147 3 PXO_00400 UPF0178 protein PXO_00400 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q5GZ95 1.58e-54 172 52 0 147 3 XOO2722 UPF0178 protein XOO2722 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P2A5 1.58e-54 172 52 0 147 3 XOO2567 UPF0178 protein XOO2567 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q7WBF2 2.92e-54 171 58 1 150 3 BPP1051 UPF0178 protein BPP1051 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q39GL2 4.39e-54 170 55 0 149 3 Bcep18194_A4809 UPF0178 protein Bcep18194_A4809 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8P8F4 1.24e-53 169 53 0 148 3 XCC2288 UPF0178 protein XCC2288 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UVN3 1.24e-53 169 53 0 148 3 XC_1827 UPF0178 protein XC_1827 Xanthomonas campestris pv. campestris (strain 8004)
B4E9B2 2.64e-53 168 55 0 149 3 BceJ2315_16760 UPF0178 protein BceJ2315_16760 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K7D5 3.43e-53 168 54 0 150 3 Bcen2424_1660 UPF0178 protein Bcen2424_1660 Burkholderia cenocepacia (strain HI2424)
B1K153 3.43e-53 168 54 0 150 3 Bcenmc03_1634 UPF0178 protein Bcenmc03_1634 Burkholderia orbicola (strain MC0-3)
Q1BWB8 3.43e-53 168 54 0 150 3 Bcen_1180 UPF0178 protein Bcen_1180 Burkholderia orbicola (strain AU 1054)
Q0K4I4 3.97e-53 168 56 0 144 3 H16_B0290 UPF0178 protein H16_B0290 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q5X8Y9 1.32e-52 166 50 0 148 3 lpp0103 UPF0178 protein lpp0103 Legionella pneumophila (strain Paris)
A5I9Q7 1.47e-52 166 50 0 148 3 LPC_0108 UPF0178 protein LPC_0108 Legionella pneumophila (strain Corby)
Q5X0D2 2.25e-52 166 50 0 148 3 lpl0088 UPF0178 protein lpl0088 Legionella pneumophila (strain Lens)
Q46QU8 2.74e-52 166 56 0 144 3 Reut_B5138 UPF0178 protein Reut_B5138 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q5ZZC2 5.29e-52 165 49 0 148 3 lpg0089 UPF0178 protein lpg0089 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q6ANP1 2.26e-51 163 56 0 144 3 DP1304 UPF0178 protein DP1304 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A1SSZ1 1.91e-49 159 50 0 149 3 Ping_0754 UPF0178 protein Ping_0754 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A4JEA9 5.95e-49 157 51 0 149 3 Bcep1808_1605 UPF0178 protein Bcep1808_1605 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q74GS4 1.83e-47 154 48 1 151 3 GSU0171 UPF0178 protein GSU0171 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B5EE88 4.93e-47 152 48 0 146 3 Gbem_2221 UPF0178 protein Gbem_2221 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q39UW8 6.12e-47 152 50 0 144 3 Gmet_1725 UPF0178 protein Gmet_1725 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
C6E870 2.01e-46 151 49 0 146 3 GM21_2006 UPF0178 protein GM21_2006 Geobacter sp. (strain M21)
C4XS40 2.24e-46 150 53 0 146 3 DMR_20710 UPF0178 protein DMR_20710 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A5G8P0 5.4e-46 150 46 0 150 3 Gura_4014 UPF0178 protein Gura_4014 Geotalea uraniireducens (strain Rf4)
Q1D104 4.53e-45 147 48 0 144 3 MXAN_5526 UPF0178 protein MXAN_5526 Myxococcus xanthus (strain DK1622)
B3E3X0 8.43e-44 144 47 0 144 3 Glov_0658 UPF0178 protein Glov_0658 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q1QE18 7.04e-39 132 43 1 148 3 Pcryo_0301 UPF0178 protein Pcryo_0301 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FV14 7.04e-39 132 43 1 148 3 Psyc_0274 UPF0178 protein Psyc_0274 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q7UXZ8 3.8e-38 130 44 2 153 3 RB974 UPF0178 protein RB974 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q30TF1 9.77e-38 129 44 0 144 3 Suden_0449 UPF0178 protein Suden_0449 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A0LH88 2.06e-37 128 41 0 149 3 Sfum_1097 UPF0178 protein Sfum_1097 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A6Q193 2.18e-35 123 40 0 150 3 NIS_0137 UPF0178 protein NIS_0137 Nitratiruptor sp. (strain SB155-2)
Q3K4U8 8.34e-35 121 40 0 144 3 Pfl01_5469 UPF0178 protein Pfl01_5469 Pseudomonas fluorescens (strain Pf0-1)
Q1I328 2.18e-34 120 39 0 149 3 PSEEN5341 UPF0178 protein PSEEN5341 Pseudomonas entomophila (strain L48)
Q88CG0 3.59e-34 120 38 0 149 3 PP_5221 UPF0178 protein PP_5221 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A4VGZ1 7.83e-34 119 40 0 144 3 PST_0536 UPF0178 protein PST_0536 Stutzerimonas stutzeri (strain A1501)
Q9HTU7 9.18e-34 119 41 1 156 3 PA5247 UPF0178 protein PA5247 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V5D7 9.91e-34 119 41 1 156 3 PLES_56411 UPF0178 protein PLES_56411 Pseudomonas aeruginosa (strain LESB58)
Q02EB7 1.94e-33 118 41 1 156 3 PA14_69280 UPF0178 protein PA14_69280 Pseudomonas aeruginosa (strain UCBPP-PA14)
A6VE23 3.31e-33 117 41 1 156 3 PSPA7_5991 UPF0178 protein PSPA7_5991 Pseudomonas aeruginosa (strain PA7)
Q4K3Y6 5.79e-33 117 40 0 144 3 PFL_5989 UPF0178 protein PFL_5989 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C3K407 5.85e-33 117 37 0 144 3 PFLU_5917 UPF0178 protein PFLU_5917 Pseudomonas fluorescens (strain SBW25)
A6Q992 2e-32 115 38 0 144 3 SUN_1096 UPF0178 protein SUN_1096 Sulfurovum sp. (strain NBC37-1)
Q138K0 1.45e-31 114 40 1 139 3 RPD_2254 UPF0178 protein RPD_2254 Rhodopseudomonas palustris (strain BisB5)
A8IL81 4.08e-31 112 37 1 149 3 AZC_4000 UPF0178 protein AZC_4000 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A4XP02 8.28e-31 111 37 0 144 3 Pmen_0294 UPF0178 protein Pmen_0294 Pseudomonas mendocina (strain ymp)
B1JFD6 9.91e-31 111 38 0 149 3 PputW619_5044 UPF0178 protein PputW619_5044 Pseudomonas putida (strain W619)
B3QFC6 1.73e-30 110 37 1 140 3 Rpal_2485 UPF0178 protein Rpal_2485 Rhodopseudomonas palustris (strain TIE-1)
Q6N7R5 3.18e-30 110 37 1 140 3 RPA2191 UPF0178 protein RPA2191 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q2IV63 3.29e-30 110 39 1 139 3 RPB_3201 UPF0178 protein RPB_3201 Rhodopseudomonas palustris (strain HaA2)
A9H867 8.43e-30 108 37 1 150 3 GDI0551 UPF0178 protein GDI0551/Gdia_1457 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q3SQN5 1.3e-29 108 37 1 140 3 Nwi_2152 UPF0178 protein Nwi_2152 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q212Q9 2.09e-29 108 36 2 152 3 RPC_3085 UPF0178 protein RPC_3085 Rhodopseudomonas palustris (strain BisB18)
B0KPA6 2.18e-29 107 36 0 149 3 PputGB1_5282 UPF0178 protein PputGB1_5282 Pseudomonas putida (strain GB-1)
C0RFM2 2.69e-28 105 36 2 150 3 BMEA_A2036 UPF0178 protein BMEA_A2036 Brucella melitensis biotype 2 (strain ATCC 23457)
Q2YR89 2.69e-28 105 36 2 150 3 BAB1_1980 UPF0178 protein BAB1_1980 Brucella abortus (strain 2308)
Q57AS5 2.69e-28 105 36 2 150 3 BruAb1_1955 UPF0178 protein BruAb1_1955 Brucella abortus biovar 1 (strain 9-941)
Q8YJJ5 2.69e-28 105 36 2 150 3 BMEI0088 UPF0178 protein BMEI0088 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A5VSU9 6.06e-28 104 36 2 150 3 BOV_1904 UPF0178 protein BOV_1904 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
B0CIY2 6.06e-28 104 36 2 150 3 BSUIS_A1819 UPF0178 protein BSUIS_A1819 Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8UFC0 7.06e-28 103 38 1 147 3 Atu1478 UPF0178 protein Atu1478 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2W3D3 9.05e-28 103 35 1 147 3 amb2838 UPF0178 protein amb2838 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A4YSR9 1.94e-27 103 35 1 144 3 BRADO3147 UPF0178 protein BRADO3147 Bradyrhizobium sp. (strain ORS 278)
Q92QD8 2.16e-27 102 38 2 148 3 R01393 UPF0178 protein R01393 Rhizobium meliloti (strain 1021)
A9M966 2.58e-27 102 36 2 150 3 BCAN_A2024 UPF0178 protein BCAN_A2024 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q8FYA6 2.58e-27 102 36 2 150 3 BR1979 UPF0178 protein BR1979/BS1330_I1973 Brucella suis biovar 1 (strain 1330)
A6WXL9 3.28e-27 102 37 2 148 3 Oant_1002 UPF0178 protein Oant_1002 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A7HTA7 5.09e-27 101 37 1 148 3 Plav_1521 UPF0178 protein Plav_1521 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B8H4A1 5.35e-27 101 37 1 147 3 CCNA_01273 UPF0178 protein CCNA_01273 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8Y2 5.35e-27 101 37 1 147 3 CC_1215 UPF0178 protein CC_1215 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q6MNN2 7.98e-27 101 33 1 150 3 Bd1212 UPF0178 protein Bd1212 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q1GQI7 4.94e-26 99 39 2 151 3 Sala_2376 UPF0178 protein Sala_2376 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q6G1Q5 1.02e-25 98 36 2 150 3 BH16190 UPF0178 protein BH16190 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q2RYA4 1.49e-25 98 34 2 150 3 Rru_A0086 UPF0178 protein Rru_A0086 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q2K827 3.7e-25 97 36 2 151 3 RHE_CH02229 UPF0178 protein RHE_CH02229 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q98LU3 1.4e-24 95 37 1 142 3 mlr0875 UPF0178 protein mlr0875 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q16D98 2.07e-24 95 37 2 144 3 RD1_0321 UPF0178 protein RD1_0321 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A3PMP8 2.08e-24 95 37 2 143 3 Rsph17029_2512 UPF0178 protein Rsph17029_2512 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B0T1K8 8.43e-24 93 35 1 147 3 Caul_3070 UPF0178 protein Caul_3070 Caulobacter sp. (strain K31)
Q3IZJ9 2.02e-23 92 36 2 143 3 RHOS4_24670 UPF0178 protein RHOS4_24670 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q0APM9 3.27e-23 92 32 1 142 3 Mmar10_1466 UPF0178 protein Mmar10_1466 Maricaulis maris (strain MCS10)
Q89N76 4.47e-23 92 36 2 154 3 bll3966 UPF0178 protein bll3966 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q5FQ96 5.21e-23 92 36 2 152 3 GOX1710 UPF0178 protein GOX1710 Gluconobacter oxydans (strain 621H)
Q5LLU4 5.52e-23 91 38 2 142 3 SPO3827 UPF0178 protein SPO3827 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B9KMJ2 1.9e-22 90 35 2 143 3 RSKD131_2223 UPF0178 protein RSKD131_2223 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
B6IP33 2.19e-22 90 36 2 143 3 RC1_2062 UPF0178 protein RC1_2062 Rhodospirillum centenum (strain ATCC 51521 / SW)
O83817 2.57e-21 87 33 0 142 3 TP_0845 UPF0178 protein TP_0845 Treponema pallidum (strain Nichols)
C1EZ79 2.48e-20 84 34 2 138 3 BCA_3127 UPF0178 protein BCA_3127 Bacillus cereus (strain 03BB102)
Q73KR6 3.31e-20 84 33 1 144 3 TDE_2151 UPF0178 protein TDE_2151 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
B9J560 8.28e-20 83 34 3 138 3 BCQ_2874 UPF0178 protein BCQ_2874 Bacillus cereus (strain Q1)
B7HVS1 1.06e-19 82 34 2 138 3 BCAH187_A3092 UPF0178 protein BCAH187_A3092 Bacillus cereus (strain AH187)
B7JDA2 1.26e-19 82 33 2 138 3 BCAH820_3075 UPF0178 protein BCAH820_3075 Bacillus cereus (strain AH820)
Q735Q6 2.3e-19 82 33 2 138 3 BCE_3095 UPF0178 protein BCE_3095 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6HH29 2.67e-19 82 33 2 138 3 BT9727_2823 UPF0178 protein BT9727_2823 Bacillus thuringiensis subsp. konkukian (strain 97-27)
A1B3B5 4.16e-19 81 33 2 143 3 Pden_1915 UPF0178 protein Pden_1915 Paracoccus denitrificans (strain Pd 1222)
A9VK81 7.65e-19 80 32 2 138 3 BcerKBAB4_2842 UPF0178 protein BcerKBAB4_2842 Bacillus mycoides (strain KBAB4)
C3P002 8.42e-19 80 32 2 138 3 BAA_3113 UPF0178 protein BAA_3113 Bacillus anthracis (strain A0248)
Q81NV9 8.42e-19 80 32 2 138 3 BA_3063 UPF0178 protein BA_3063/GBAA_3063/BAS2849 Bacillus anthracis
C3LEQ2 8.42e-19 80 32 2 138 3 BAMEG_1545 UPF0178 protein BAMEG_1545 Bacillus anthracis (strain CDC 684 / NRRL 3495)
Q639P8 8.89e-19 80 32 2 138 3 BCE33L2782 UPF0178 protein BCE33L2782 Bacillus cereus (strain ZK / E33L)
B7H8F2 1.84e-18 79 32 2 138 3 BCB4264_A3061 UPF0178 protein BCB4264_A3061 Bacillus cereus (strain B4264)
Q81BV3 1.84e-18 79 32 2 138 3 BC_3040 UPF0178 protein BC_3040 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7ILR6 3.05e-18 79 32 2 138 3 BCG9842_B2187 UPF0178 protein BCG9842_B2187 Bacillus cereus (strain G9842)
Q8ET11 4.12e-18 79 32 4 142 3 OB0454 UPF0178 protein OB0454 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q891H3 4.21e-17 76 34 5 153 3 CTC_02403 UPF0178 protein CTC_02403 Clostridium tetani (strain Massachusetts / E88)
A4WX92 1.45e-16 75 34 2 143 3 Rsph17025_3122 UPF0178 protein Rsph17025_3122 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q28QC7 1.85e-16 74 36 2 144 3 Jann_2168 UPF0178 protein Jann_2168 Jannaschia sp. (strain CCS1)
Q9KD45 2.58e-16 74 28 1 145 3 BH1374 UPF0178 protein BH1374 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A7Z6T7 4.9e-16 73 33 2 143 3 RBAM_023530 UPF0178 protein RBAM_023530 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A6TSH1 5.72e-16 73 31 1 144 3 Amet_2995 UPF0178 protein Amet_2995 Alkaliphilus metalliredigens (strain QYMF)
A8FFA7 1.46e-14 70 32 2 143 3 BPUM_2255 UPF0178 protein BPUM_2255 Bacillus pumilus (strain SAFR-032)
P17868 2.65e-14 69 34 3 144 3 yqxD UPF0178 protein YqxD Bacillus subtilis (strain 168)
A7GSZ0 1.54e-13 67 31 3 148 3 Bcer98_3021 UPF0178 protein Bcer98_3021 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q65H79 4.49e-13 66 33 3 143 3 BLi02714 UPF0178 protein BLi02714/BL03680 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A5N2Y5 5.27e-13 65 28 2 148 3 CKL_3490 UPF0178 protein CKL_3490 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DWN6 5.27e-13 65 28 2 148 3 CKR_3078 UPF0178 protein CKR_3078 Clostridium kluyveri (strain NBRC 12016)
P52309 2.25e-12 63 30 1 142 3 lmo1456 UPF0178 protein Lmo1456 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q837J5 8.5e-12 62 30 3 142 3 EF_0842 UPF0178 protein EF_0842 Enterococcus faecalis (strain ATCC 700802 / V583)
Q0AWU6 1.42e-11 62 30 1 145 3 Swol_1505 UPF0178 protein Swol_1505 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q49VM7 2.13e-11 61 28 3 150 3 SSP2038 UPF0178 protein SSP2038 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q71ZL4 2.37e-11 61 28 1 142 3 LMOf2365_1475 UPF0178 protein LMOf2365_1475 Listeria monocytogenes serotype 4b (strain F2365)
C1KVA3 2.37e-11 61 28 1 142 3 Lm4b_01466 UPF0178 protein Lm4b_01466 Listeria monocytogenes serotype 4b (strain CLIP80459)
A0AIQ7 3.2e-11 60 28 1 142 3 lwe1471 UPF0178 protein lwe1471 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q97FB5 5.54e-11 60 28 3 150 3 CA_C2825 UPF0178 protein CA_C2825 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B1YED2 6.25e-11 60 27 2 147 3 Exig_1155 UPF0178 protein Exig_1155 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A9KQ87 3.02e-10 58 29 4 148 3 Cphy_3042 UPF0178 protein Cphy_3042 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A0Q2Q9 3.15e-10 58 26 3 152 3 NT01CX_0440 UPF0178 protein NT01CX_0440 Clostridium novyi (strain NT)
Q92BQ4 3.83e-10 58 27 1 142 3 lin1493 UPF0178 protein Lin1493 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q5WHD2 1e-09 57 28 1 138 3 ABC1688 UPF0178 protein ABC1688 Shouchella clausii (strain KSM-K16)
A8MKA8 1.32e-09 56 28 3 146 3 Clos_2709 UPF0178 protein Clos_2709 Alkaliphilus oremlandii (strain OhILAs)
Q0TN52 1.63e-09 56 25 2 141 3 CPF_2548 UPF0178 protein CPF_2548 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8XI55 1.63e-09 56 25 2 141 3 CPE2266 UPF0178 protein CPE2266 Clostridium perfringens (strain 13 / Type A)
B8I8V6 1.98e-09 56 30 3 135 3 Ccel_2994 UPF0178 protein Ccel_2994 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B2A5Z1 2.49e-09 55 28 4 149 3 Nther_1836 UPF0178 protein Nther_1836 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q0SQT0 3.49e-09 55 25 3 152 3 CPR_2251 UPF0178 protein CPR_2251 Clostridium perfringens (strain SM101 / Type A)
Q4L4A4 1.37e-08 53 27 2 136 3 SH2212 UPF0178 protein SH2212 Staphylococcus haemolyticus (strain JCSC1435)
B0TIB8 3.11e-07 50 25 1 144 3 Helmi_09130 UPF0178 protein Helmi_09130 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q5HR57 5.23e-07 49 25 2 146 3 SERP0336 UPF0178 protein SERP0336 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CTJ9 9.02e-07 48 25 2 146 3 SE_0451 UPF0178 protein SE_0451 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05085
Feature type CDS
Gene -
Product YaiI/YqxD family protein
Location 1084051 - 1084515 (strand: -1)
Length 465 (nucleotides) / 154 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_754
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02639 Uncharacterized BCR, YaiI/YqxD family COG1671

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1671 Function unknown (S) S Uncharacterized conserved protein YaiI, UPF0178 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09768 uncharacterized protein - -

Protein Sequence

MAIWVDADACPKVIKEILYRAADREKIEITFVANQRLVVPASPFLRTLQVPAGFDVADNEIVRRVQTDELVITADIPLAAEVLEKGGVALNPRGERYSNATIRERLTMRDFMDTMRASGVQTGGPATMNQRDRQQFANELDKWLLQRKKRLAAS

Flanking regions ( +/- flanking 50bp)

GACGTCATTCCGGTATTCTTAGCGCAATATACCTGTTCAGAGGAAATACCATGGCAATCTGGGTCGATGCTGACGCCTGTCCGAAAGTAATTAAAGAGATACTCTACAGAGCGGCAGATCGCGAAAAAATAGAGATTACATTTGTTGCCAACCAGCGCCTGGTTGTACCGGCATCTCCGTTTCTGCGGACATTACAGGTGCCCGCCGGGTTTGATGTCGCCGATAACGAAATTGTCCGCCGGGTTCAGACTGATGAACTGGTGATCACCGCCGATATTCCGCTGGCAGCGGAAGTGCTGGAAAAGGGCGGTGTTGCGCTCAATCCGCGTGGCGAACGCTATAGCAATGCCACTATCCGTGAACGCCTGACTATGCGTGATTTTATGGACACCATGCGTGCCAGCGGTGTTCAGACCGGCGGTCCGGCAACCATGAATCAGCGTGACCGTCAGCAGTTTGCCAATGAACTGGATAAATGGTTGTTACAGCGTAAAAAACGTCTCGCAGCGTCCTGATATCCCCTCACTATTAATATATTAATGTTTTCCGGGCTGCATGATGTGGC