Homologs in group_2579

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02550 FBDBKF_02550 79.8 Morganella morganii S1 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
EHELCC_03020 EHELCC_03020 79.8 Morganella morganii S2 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
NLDBIP_00440 NLDBIP_00440 79.8 Morganella morganii S4 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
LHKJJB_01595 LHKJJB_01595 79.8 Morganella morganii S3 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
HKOGLL_01635 HKOGLL_01635 79.8 Morganella morganii S5 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Distribution of the homologs in the orthogroup group_2579

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2579

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P67430 3.4e-101 293 72 0 199 1 nemR HTH-type transcriptional repressor NemR Escherichia coli (strain K12)
P67431 3.4e-101 293 72 0 199 3 nemR HTH-type transcriptional repressor NemR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9RAJ1 1.65e-20 87 28 1 182 4 dhaR HTH-type transcriptional repressor DhaR Mycobacterium sp. (strain GP1)
Q3J6K8 2.96e-17 79 31 2 176 1 acuR Transcriptional regulator AcuR Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
P42097 1.33e-07 53 26 2 138 4 None Uncharacterized HTH-type transcriptional regulator in lacX 3'region Lactococcus lactis subsp. lactis
P40950 1.35e-06 50 29 1 86 4 yuxN Uncharacterized HTH-type transcriptional regulator YuxN Bacillus subtilis (strain 168)
P39897 9.69e-05 45 25 6 166 1 mtrR HTH-type transcriptional regulator MtrR Neisseria gonorrhoeae
Q9RMY4 0.000487 42 21 3 177 4 pXO2-48 Uncharacterized HTH-type transcriptional regulator pXO2-48/BXB0055/GBAA_pXO2_0055 Bacillus anthracis

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS04975
Feature type CDS
Gene -
Product TetR/AcrR family transcriptional regulator
Location 1060169 - 1060768 (strand: -1)
Length 600 (nucleotides) / 199 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2579
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00440 Bacterial regulatory proteins, tetR family
PF16925 Tetracyclin repressor-like, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1309 Transcription (K) K DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K16137 TetR/AcrR family transcriptional regulator, transcriptional repressor for nem operon - -

Protein Sequence

MNRQTDHDTREHLLATGEQLCLHRGFTGMGLSELLRTAEVPKGSFYHYFRSKEAFGVAMLERYYADYLTRLADHFERGEGCYRARFLAYYGEMLKNACQHSRIHGCLTVKLSAEVCDLSEDMNAAMDKGVSRVIALLAQALENGHDEKSLVFSGSSLATAQVLYSLWLGANLQAKISRSAVPLESALAHVNVLLTAPDV

Flanking regions ( +/- flanking 50bp)

TTGTTTCAAATAAACTTGCACCAGACCGATCGGTCTATTACAGTATTTGCATGAACAGACAGACTGACCATGATACCCGTGAACACCTTTTAGCCACCGGCGAACAGCTTTGCCTGCACCGGGGGTTTACCGGAATGGGACTGAGCGAACTGCTCAGAACCGCAGAAGTGCCTAAGGGGTCGTTTTACCACTATTTCCGCTCAAAAGAGGCGTTCGGTGTTGCTATGCTGGAGCGTTATTATGCGGATTATCTCACGCGCTTAGCCGATCATTTTGAGCGCGGGGAAGGGTGTTACCGGGCGCGTTTTCTCGCATATTACGGGGAAATGCTGAAAAATGCCTGTCAGCACAGCCGGATCCACGGGTGCCTGACCGTTAAGTTATCAGCGGAAGTCTGTGATTTATCAGAAGATATGAATGCCGCAATGGATAAGGGTGTCAGCAGGGTCATTGCCTTGCTGGCGCAGGCGCTGGAAAACGGGCATGATGAAAAATCGCTCGTTTTCAGCGGCAGTTCTCTTGCTACCGCACAGGTTTTATATTCCCTGTGGCTGGGCGCGAATTTGCAGGCCAAGATTTCCCGCAGTGCTGTCCCGCTGGAAAGCGCGCTGGCACATGTGAATGTATTGCTTACAGCGCCGGATGTATAACCGGCGTTTTTATTTACCCAATCACTAGTCGACTGGTCTAATCCGGAGAT