Homologs in group_4713

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4713

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4713

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS04860
Feature type CDS
Gene -
Product cupin
Location 1033733 - 1034044 (strand: 1)
Length 312 (nucleotides) / 103 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_4713
Orthogroup size 1
N. genomes 1

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0662 Carbohydrate transport and metabolism (G) G Mannose-6-phosphate isomerase, cupin superfamily

Protein Sequence

MKTYKSKDFTADKAWQALDIANFDGTTVRLHWTDKAYKWHVNDGQEVFAVMDGTVEMHYKENGETKQVILNAGDILYAGIGCEHVAHPVGEARILVIEKEGSV

Flanking regions ( +/- flanking 50bp)

GCAAATATTAAATACAAAATAACTGATTGATAATTACAAAAAATCACAAAATGAAAACATACAAAAGCAAAGACTTTACCGCAGACAAAGCCTGGCAGGCATTAGATATTGCTAATTTTGACGGCACAACAGTACGGTTGCATTGGACAGATAAAGCATACAAATGGCACGTTAATGACGGACAAGAAGTTTTCGCCGTCATGGATGGCACTGTAGAAATGCATTACAAAGAGAATGGCGAGACTAAGCAAGTTATCTTAAATGCCGGTGATATTCTTTATGCCGGTATCGGCTGTGAGCATGTTGCACATCCGGTGGGTGAAGCCAGAATACTGGTGATTGAAAAAGAGGGCTCCGTTTAGGGGGGGGGATATAACCAGCTAAAGTGTCAGATTTCTCCATTAGCTACCTT