Homologs in group_579

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01655 FBDBKF_01655 78.7 Morganella morganii S1 yebF protein YebF
EHELCC_02125 EHELCC_02125 78.7 Morganella morganii S2 yebF protein YebF
NLDBIP_01335 NLDBIP_01335 78.7 Morganella morganii S4 yebF protein YebF
LHKJJB_00700 LHKJJB_00700 78.7 Morganella morganii S3 yebF protein YebF
HKOGLL_00740 HKOGLL_00740 78.7 Morganella morganii S5 yebF protein YebF
PMI_RS07825 PMI_RS07825 41.7 Proteus mirabilis HI4320 yebF protein YebF

Distribution of the homologs in the orthogroup group_579

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_579

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N3M3 1.12e-30 109 44 3 127 3 yebF Protein YebF Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q66BW1 5.44e-24 92 44 3 119 3 yebF Protein YebF Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZFD5 5.44e-24 92 44 3 119 3 yebF Protein YebF Yersinia pestis
A7FJ88 5.44e-24 92 44 3 119 3 yebF Protein YebF Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q3Z2J8 1.59e-21 85 43 1 91 3 yebF Protein YebF Shigella sonnei (strain Ss046)
Q322G8 1.59e-21 85 43 1 91 3 yebF Protein YebF Shigella boydii serotype 4 (strain Sb227)
Q8CVZ5 1.59e-21 85 43 1 91 3 yebF Protein YebF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XCK0 1.59e-21 85 43 1 91 3 yebF Protein YebF Escherichia coli O157:H7
P33219 2.32e-21 85 43 1 91 1 yebF Protein YebF Escherichia coli (strain K12)
Q83KS1 5.9e-21 84 43 1 91 3 yebF Protein YebF Shigella flexneri
Q8ZNW7 8.9e-19 78 43 1 88 3 yebF Protein YebF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z5X5 8.9e-19 78 43 1 88 3 yebF Protein YebF Salmonella typhi
B4TYQ4 8.9e-19 78 43 1 88 3 yebF Protein YebF Salmonella schwarzengrund (strain CVM19633)
B5BH73 8.9e-19 78 43 1 88 3 yebF Protein YebF Salmonella paratyphi A (strain AKU_12601)
C0Q2H0 8.9e-19 78 43 1 88 3 yebF Protein YebF Salmonella paratyphi C (strain RKS4594)
A9MUZ0 8.9e-19 78 43 1 88 3 yebF Protein YebF Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PI99 8.9e-19 78 43 1 88 3 yebF Protein YebF Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SVD1 8.9e-19 78 43 1 88 3 yebF Protein YebF Salmonella newport (strain SL254)
B4T7X9 8.9e-19 78 43 1 88 3 yebF Protein YebF Salmonella heidelberg (strain SL476)
B5R8F6 8.9e-19 78 43 1 88 3 yebF Protein YebF Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1X2 8.9e-19 78 43 1 88 3 yebF Protein YebF Salmonella enteritidis PT4 (strain P125109)
B5FSQ2 8.9e-19 78 43 1 88 3 yebF Protein YebF Salmonella dublin (strain CT_02021853)
Q57NB9 8.9e-19 78 43 1 88 3 yebF Protein YebF Salmonella choleraesuis (strain SC-B67)
B5F3L0 8.9e-19 78 43 1 88 3 yebF Protein YebF Salmonella agona (strain SL483)
Q32HB5 1.87e-17 75 40 1 91 3 yebF Protein YebF Shigella dysenteriae serotype 1 (strain Sd197)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03995
Feature type CDS
Gene yebF
Product protein YebF
Location 847655 - 848038 (strand: 1)
Length 384 (nucleotides) / 127 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_579
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13995 YebF-like protein

Protein Sequence

MNVINLCTRIGLSGAGILLAFTVSAQTPVKPVVDNQRMVTFPTCDSLTKDQVAAQVKYDFVQNRYTRWQDDKALLGSKPVAWVNTADVTEKDGNYSVPLTVRGSKKQLSYIVDINCAAQTMTYGLPK

Flanking regions ( +/- flanking 50bp)

GTATATAAGACAACATTTAATCTCAGACAGAGATAAAAACAGGAGGTTTTATGAACGTAATCAATCTGTGTACCCGCATCGGATTATCAGGTGCCGGTATACTGCTGGCGTTTACGGTAAGTGCGCAAACACCGGTAAAACCGGTTGTTGACAATCAGCGCATGGTGACATTTCCGACGTGTGATTCACTGACAAAAGATCAGGTTGCAGCACAGGTTAAGTATGACTTTGTGCAAAACCGCTATACCCGCTGGCAGGATGATAAAGCGCTGCTGGGCAGCAAACCGGTTGCGTGGGTGAATACCGCTGACGTAACTGAAAAAGACGGTAATTACAGTGTGCCGCTGACAGTGCGTGGCTCGAAAAAACAGCTCAGTTATATTGTCGATATTAATTGTGCCGCACAAACAATGACATACGGTCTGCCAAAGTAGCAATCCACTATGTGACCCGGCGGGCGTAGTGTAGCCAACGAACCTGCGGT