Homologs in group_572

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01505 FBDBKF_01505 89.1 Morganella morganii S1 bamE outer membrane protein assembly factor BamE
EHELCC_00040 EHELCC_00040 89.1 Morganella morganii S2 bamE outer membrane protein assembly factor BamE
NLDBIP_03420 NLDBIP_03420 89.1 Morganella morganii S4 bamE outer membrane protein assembly factor BamE
LHKJJB_04935 LHKJJB_04935 89.1 Morganella morganii S3 bamE outer membrane protein assembly factor BamE
HKOGLL_02110 HKOGLL_02110 89.1 Morganella morganii S5 bamE outer membrane protein assembly factor BamE
PMI_RS09390 PMI_RS09390 64.2 Proteus mirabilis HI4320 bamE outer membrane protein assembly factor BamE

Distribution of the homologs in the orthogroup group_572

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_572

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CH39 1.53e-58 179 74 0 106 3 bamE Outer membrane protein assembly factor BamE Yersinia pestis
Q7CPZ3 1.56e-56 174 73 0 106 3 bamE Outer membrane protein assembly factor BamE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A939 2.11e-54 169 71 0 106 3 bamE Outer membrane protein assembly factor BamE Shigella flexneri
Q32CX2 2.11e-54 169 71 0 106 3 bamE Outer membrane protein assembly factor BamE Shigella dysenteriae serotype 1 (strain Sd197)
P0A937 2.11e-54 169 71 0 106 1 bamE Outer membrane protein assembly factor BamE Escherichia coli (strain K12)
P0A938 2.11e-54 169 71 0 106 3 bamE Outer membrane protein assembly factor BamE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P44057 6.6e-29 105 50 1 103 3 bamE Outer membrane protein assembly factor BamE Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5E3A2 7.59e-23 89 41 0 105 3 bamE Outer membrane protein assembly factor BamE Aliivibrio fischeri (strain ATCC 700601 / ES114)
P0C6Q9 1.09e-21 86 40 1 101 3 bamE Outer membrane protein assembly factor BamE Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F378 1.09e-21 86 40 1 101 3 bamE Outer membrane protein assembly factor BamE Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q8EGW5 9.04e-19 80 37 4 114 3 bamE Outer membrane protein assembly factor BamE Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
E1VAU8 1.94e-17 76 40 4 109 3 bamE Outer membrane protein assembly factor BamE Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)
A1SV87 2.2e-17 75 36 1 91 3 bamE Outer membrane protein assembly factor BamE Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q82WP8 1.78e-14 68 42 0 76 3 bamE Outer membrane protein assembly factor BamE Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
O68564 5.64e-13 65 33 3 109 3 bamE Outer membrane protein assembly factor BamE Pseudomonas fluorescens
F0KFM4 8.01e-13 63 34 2 103 3 bamE Outer membrane protein assembly factor BamE Acinetobacter pittii (strain PHEA-2)
Q4FV24 3.9e-12 62 30 2 117 3 bamE Outer membrane protein assembly factor BamE Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
O68562 5.15e-12 62 34 1 85 1 bamE Outer membrane protein assembly factor BamE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
G0A7H1 1.28e-11 61 38 0 71 3 bamE Outer membrane protein assembly factor BamE Methylomonas methanica (strain DSM 25384 / MC09)
Q8PAL4 1.72e-11 60 42 2 75 3 bamE Outer membrane protein assembly factor BamE Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B1XT70 4.69e-11 60 34 3 104 3 bamE Outer membrane protein assembly factor BamE Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q9K1F0 6.44e-10 56 40 2 81 3 bamE Outer membrane protein assembly factor BamE Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q8K9V7 1.2e-06 47 27 3 91 3 bamE Outer membrane protein assembly factor BamE Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57283 6.09e-06 45 24 1 83 3 bamE Outer membrane protein assembly factor BamE Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A0A160PB22 1.48e-05 46 26 4 104 1 tpgA Trimeric autotransporter adhesin- and peptidoglycan-associated protein A Acinetobacter sp. (strain Tol 5)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01900
Feature type CDS
Gene bamE
Product outer membrane protein assembly factor BamE
Location 416372 - 416758 (strand: -1)
Length 387 (nucleotides) / 128 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_572
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04355 SmpA / OmlA family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2913 Cell wall/membrane/envelope biogenesis (M) M Outer membrane protein assembly factor BamE, lipoprotein component of the BamABCDE complex

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06186 outer membrane protein assembly factor BamE - -

Protein Sequence

MRCKLLIAATTSLLLLTAGCSTLERVVYRPDINQGNYLTPADVAKIQTGMTQQQVAYTLGTPMLRDPFGTQTWHYVFRREPGHQKVKQETLTLSFDAAGKLTEIKNTDYKPDNGDETTSEIASETVKD

Flanking regions ( +/- flanking 50bp)

TTATTGTCGATTATCATCGTCACCATGAATCCTAAAGGAATGAAATCACCATGCGTTGTAAATTGCTGATTGCCGCAACGACATCTCTGTTGCTGTTAACTGCCGGATGTTCCACTCTGGAGCGTGTGGTCTACCGCCCTGATATCAACCAGGGGAACTATCTCACACCAGCAGATGTAGCGAAAATCCAGACAGGAATGACTCAGCAGCAAGTTGCCTATACTCTTGGTACGCCGATGTTACGTGATCCGTTCGGAACGCAAACATGGCACTATGTTTTCCGCCGTGAGCCGGGTCACCAGAAAGTAAAACAAGAAACACTGACACTCAGCTTCGATGCCGCCGGCAAGCTGACTGAAATCAAGAATACGGATTACAAACCTGATAACGGGGATGAAACCACAAGCGAAATCGCAAGTGAGACCGTAAAAGACTAATTCATCATTATCATGCACGTCTGACGTATGGTGAACTGTAAAAAACCGCT