Homologs in group_1304

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07245 FBDBKF_07245 93.0 Morganella morganii S1 gloB Glyoxylase or a related metal-dependent hydrolase, beta-lactamase superfamily II
EHELCC_03725 EHELCC_03725 93.0 Morganella morganii S2 gloB Glyoxylase or a related metal-dependent hydrolase, beta-lactamase superfamily II
NLDBIP_03725 NLDBIP_03725 93.0 Morganella morganii S4 gloB Glyoxylase or a related metal-dependent hydrolase, beta-lactamase superfamily II
LHKJJB_09555 LHKJJB_09555 93.0 Morganella morganii S3 gloB Glyoxylase or a related metal-dependent hydrolase, beta-lactamase superfamily II
HKOGLL_09420 HKOGLL_09420 93.0 Morganella morganii S5 gloB Glyoxylase or a related metal-dependent hydrolase, beta-lactamase superfamily II
PMI_RS03600 PMI_RS03600 70.7 Proteus mirabilis HI4320 - MBL fold metallo-hydrolase

Distribution of the homologs in the orthogroup group_1304

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1304

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P75849 2.06e-108 313 65 0 215 1 gloC Hydroxyacylglutathione hydrolase GloC Escherichia coli (strain K12)
Q57544 1.3e-70 217 50 2 213 3 gloC Hydroxyacylglutathione hydrolase GloC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O67893 5.09e-39 136 38 5 212 3 aq_2135 Uncharacterized protein aq_2135 Aquifex aeolicus (strain VF5)
P54501 1.71e-37 132 35 1 209 3 yqgX Probable metallo-hydrolase YqgX Bacillus subtilis (strain 168)
P64262 5.53e-32 119 35 5 218 3 BQ2027_MB2612C Uncharacterized protein Mb2612c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMW3 5.53e-32 119 35 5 218 1 Rv2581c Uncharacterized protein Rv2581c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMW2 5.53e-32 119 35 5 218 3 MT2658 Uncharacterized protein MT2658 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q49649 3.36e-30 114 37 9 215 3 ML0493 Uncharacterized protein ML0493 Mycobacterium leprae (strain TN)
Q5XD24 8e-28 108 31 2 193 1 M6_Spy0554 Probable metallo-hydrolase M6_Spy0554 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q6ML19 2.9e-21 91 37 6 158 3 gloB Hydroxyacylglutathione hydrolase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A4G7G5 4.39e-21 91 30 8 249 3 gloB Hydroxyacylglutathione hydrolase Herminiimonas arsenicoxydans
Q6D1V5 3.05e-19 86 31 7 203 3 gloB Hydroxyacylglutathione hydrolase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DC67 8.85e-19 84 30 8 212 3 gloB Hydroxyacylglutathione hydrolase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
O95571 4.15e-18 83 30 6 204 1 ETHE1 Persulfide dioxygenase ETHE1, mitochondrial Homo sapiens
Q2J429 1.08e-17 82 33 4 176 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain HaA2)
A4SPI6 1.73e-17 81 34 7 163 3 gloB Hydroxyacylglutathione hydrolase Aeromonas salmonicida (strain A449)
P57336 2.94e-17 80 31 5 164 3 gloB Hydroxyacylglutathione hydrolase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9C8L4 8.53e-17 80 30 5 203 1 GLY3 Persulfide dioxygenase ETHE1 homolog, mitochondrial Arabidopsis thaliana
Q58298 9.15e-17 78 32 9 194 3 MJ0888 Probable metallo-hydrolase MJ0888 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9DCM0 9.62e-17 79 30 6 205 1 Ethe1 Persulfide dioxygenase ETHE1, mitochondrial Mus musculus
Q92MF8 4.5e-16 77 28 6 225 3 gloB Hydroxyacylglutathione hydrolase Rhizobium meliloti (strain 1021)
Q3T094 5.25e-16 77 28 5 204 2 ETHE1 Persulfide dioxygenase ETHE1, mitochondrial Bos taurus
Q5QZL0 5.45e-16 77 36 5 146 3 gloB Hydroxyacylglutathione hydrolase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A4W6V2 5.8e-16 77 32 4 158 3 gloB Hydroxyacylglutathione hydrolase Enterobacter sp. (strain 638)
Q3IIR9 6.92e-16 77 33 7 161 3 gloB Hydroxyacylglutathione hydrolase Pseudoalteromonas translucida (strain TAC 125)
A7MY07 7.99e-16 77 31 7 190 3 gloB Hydroxyacylglutathione hydrolase Vibrio campbellii (strain ATCC BAA-1116)
A4YKS8 8.34e-16 77 34 5 176 3 gloB Hydroxyacylglutathione hydrolase Bradyrhizobium sp. (strain ORS 278)
A1JKA9 8.55e-16 76 32 4 157 3 gloB Hydroxyacylglutathione hydrolase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
O94250 3.27e-15 75 27 8 202 3 SPCC13B11.03c Probable hydroxyacylglutathione hydrolase SPCC13B11.03c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q11DS3 3.54e-15 75 28 7 228 3 gloB Hydroxyacylglutathione hydrolase Chelativorans sp. (strain BNC1)
Q13F06 3.57e-15 75 31 5 176 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain BisB5)
A4TL56 7.86e-15 74 28 6 189 3 gloB Hydroxyacylglutathione hydrolase Yersinia pestis (strain Pestoides F)
B1JR44 7.94e-15 74 30 4 158 3 gloB Hydroxyacylglutathione hydrolase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667M5 7.94e-15 74 30 4 158 3 gloB Hydroxyacylglutathione hydrolase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2KAD1 7.94e-15 74 30 4 158 3 gloB Hydroxyacylglutathione hydrolase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FFK5 7.94e-15 74 30 4 158 3 gloB Hydroxyacylglutathione hydrolase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1CFI4 8.52e-15 73 30 4 158 3 gloB Hydroxyacylglutathione hydrolase Yersinia pestis bv. Antiqua (strain Nepal516)
Q0WHW5 8.52e-15 73 30 4 158 3 gloB Hydroxyacylglutathione hydrolase Yersinia pestis
Q1CAJ7 8.52e-15 73 30 4 158 3 gloB Hydroxyacylglutathione hydrolase Yersinia pestis bv. Antiqua (strain Antiqua)
Q87MG0 1.03e-14 73 31 7 190 3 gloB Hydroxyacylglutathione hydrolase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A5ETG1 1.05e-14 73 29 6 228 3 gloB Hydroxyacylglutathione hydrolase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q8DBD8 1.41e-14 73 31 7 190 3 gloB Hydroxyacylglutathione hydrolase Vibrio vulnificus (strain CMCP6)
Q7MII4 1.41e-14 73 31 7 190 3 gloB2 Hydroxyacylglutathione hydrolase 2 Vibrio vulnificus (strain YJ016)
A1SS88 1.81e-14 73 33 7 157 3 gloB Hydroxyacylglutathione hydrolase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B5Y1G4 2.5e-14 72 26 7 212 3 gloB Hydroxyacylglutathione hydrolase Klebsiella pneumoniae (strain 342)
C3LPP0 2.69e-14 72 25 8 247 3 gloB Hydroxyacylglutathione hydrolase Vibrio cholerae serotype O1 (strain M66-2)
Q9KPX6 2.69e-14 72 25 8 247 3 gloB Hydroxyacylglutathione hydrolase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F635 2.69e-14 72 25 8 247 3 gloB Hydroxyacylglutathione hydrolase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q08889 2.75e-14 72 28 6 200 3 gloB Hydroxyacylglutathione hydrolase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89XT5 4.02e-14 72 27 6 228 3 gloB Hydroxyacylglutathione hydrolase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8UAA9 4.03e-14 73 31 8 195 2 blh Beta-lactamase hydrolase-like protein Agrobacterium fabrum (strain C58 / ATCC 33970)
Q4FP49 4.77e-14 72 29 6 194 3 gloB Hydroxyacylglutathione hydrolase Pelagibacter ubique (strain HTCC1062)
Q8DIF1 4.93e-14 72 33 4 140 3 gloB Hydroxyacylglutathione hydrolase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q6NC62 5.33e-14 72 31 4 170 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8N490 5.51e-14 73 27 10 251 1 PNKD Probable hydrolase PNKD Homo sapiens
A6T510 8.15e-14 71 26 7 212 3 gloB Hydroxyacylglutathione hydrolase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q2RP80 9.59e-14 71 25 7 229 3 gloB Hydroxyacylglutathione hydrolase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q1LL91 1.37e-13 70 32 10 202 3 gloB Hydroxyacylglutathione hydrolase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q5WX41 1.4e-13 70 30 5 162 3 gloB Hydroxyacylglutathione hydrolase Legionella pneumophila (strain Lens)
Q9PFB0 1.58e-13 72 28 6 214 2 blh Beta-lactamase hydrolase-like protein Xylella fastidiosa (strain 9a5c)
A5IBE7 1.6e-13 70 30 5 162 3 gloB Hydroxyacylglutathione hydrolase Legionella pneumophila (strain Corby)
Q5ZVZ3 1.86e-13 70 30 5 162 3 gloB Hydroxyacylglutathione hydrolase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
B0TXY0 2.15e-13 70 28 4 192 3 gloB Hydroxyacylglutathione hydrolase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A4XU09 2.4e-13 70 30 4 173 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas mendocina (strain ymp)
Q2JVC3 2.71e-13 70 25 6 245 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain JA-3-3Ab)
A3PBT3 3.47e-13 69 28 7 191 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9301)
Q9SID3 3.47e-13 70 29 7 193 1 At2g31350 Hydroxyacylglutathione hydrolase 2, mitochondrial Arabidopsis thaliana
Q7MQ55 3.48e-13 69 29 8 193 3 gloB1 Hydroxyacylglutathione hydrolase 1 Vibrio vulnificus (strain YJ016)
Q2JPX4 3.48e-13 69 26 8 235 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q2NVG1 4.24e-13 69 28 3 157 3 gloB Hydroxyacylglutathione hydrolase Sodalis glossinidius (strain morsitans)
B3R1Y0 4.74e-13 69 28 11 254 3 gloB Hydroxyacylglutathione hydrolase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q9UT36 5.29e-13 69 27 9 202 3 glo2 Probable hydroxyacylglutathione hydrolase glo2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q87AD6 5.57e-13 70 28 9 229 3 blh Beta-lactamase hydrolase-like protein Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q31BX5 6.95e-13 68 29 7 172 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9312)
B1JBN3 6.96e-13 68 33 4 160 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas putida (strain W619)
B7K3R6 9.56e-13 68 29 7 182 3 gloB Hydroxyacylglutathione hydrolase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q48KX8 1.17e-12 68 28 8 245 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1H188 1.52e-12 67 31 6 161 3 gloB Hydroxyacylglutathione hydrolase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
C4K7Z9 1.91e-12 67 26 7 209 3 gloB Hydroxyacylglutathione hydrolase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q46Z82 2.05e-12 67 27 12 259 3 gloB Hydroxyacylglutathione hydrolase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A7YY46 2.21e-12 68 26 10 251 2 PNKD Probable hydrolase PNKD Bos taurus
Q7VQB7 2.26e-12 67 26 7 200 3 gloB Hydroxyacylglutathione hydrolase Blochmanniella floridana
Q4ZVL3 2.28e-12 67 27 8 242 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas syringae pv. syringae (strain B728a)
O34769 2.42e-12 67 22 6 217 1 pksB Probable polyketide biosynthesis zinc-dependent hydrolase PksB Bacillus subtilis (strain 168)
Q5X5R2 2.92e-12 67 29 5 162 3 gloB Hydroxyacylglutathione hydrolase Legionella pneumophila (strain Paris)
A6VVZ9 2.96e-12 67 29 7 175 3 gloB Hydroxyacylglutathione hydrolase Marinomonas sp. (strain MWYL1)
Q69ZP3 3.31e-12 68 29 9 198 1 Pnkd Probable hydrolase PNKD Mus musculus
A2BQ40 3.36e-12 67 29 7 170 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain AS9601)
Q21C03 3.53e-12 67 26 7 236 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain BisB18)
B4SLN7 3.9e-12 66 31 6 179 3 gloB Hydroxyacylglutathione hydrolase Stenotrophomonas maltophilia (strain R551-3)
Q21YF8 5.64e-12 66 29 7 192 3 gloB Hydroxyacylglutathione hydrolase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B8ICA2 5.81e-12 66 28 6 225 3 gloB Hydroxyacylglutathione hydrolase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q98G02 5.87e-12 66 31 3 134 3 gloB Hydroxyacylglutathione hydrolase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A9IZW8 6.74e-12 66 26 6 225 3 gloB Hydroxyacylglutathione hydrolase Bartonella tribocorum (strain CIP 105476 / IBS 506)
A1WXD9 6.75e-12 66 31 5 155 3 gloB Hydroxyacylglutathione hydrolase Halorhodospira halophila (strain DSM 244 / SL1)
A0Q7M7 7.74e-12 65 24 6 215 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. novicida (strain U112)
Q60BX0 8.65e-12 65 26 8 226 3 gloB Hydroxyacylglutathione hydrolase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8LDW8 8.7e-12 66 26 7 193 2 GLX2-4 Probable hydroxyacylglutathione hydrolase 2, chloroplastic Arabidopsis thaliana
Q8U9W1 9.28e-12 65 30 5 171 3 gloB Hydroxyacylglutathione hydrolase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8FYE7 9.85e-12 65 28 5 176 3 gloB Hydroxyacylglutathione hydrolase Brucella suis biovar 1 (strain 1330)
A5VSR1 9.85e-12 65 28 5 176 3 gloB Hydroxyacylglutathione hydrolase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YJF4 9.85e-12 65 28 5 176 3 gloB Hydroxyacylglutathione hydrolase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57AW2 9.85e-12 65 28 5 176 3 gloB Hydroxyacylglutathione hydrolase Brucella abortus biovar 1 (strain 9-941)
Q2YLU8 9.85e-12 65 28 5 176 3 gloB Hydroxyacylglutathione hydrolase Brucella abortus (strain 2308)
Q8Z983 1.02e-11 65 29 7 195 3 gloB Hydroxyacylglutathione hydrolase Salmonella typhi
Q8PBY0 1.06e-11 65 33 4 135 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RTE9 1.06e-11 65 33 4 135 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas campestris pv. campestris (strain B100)
Q4URM1 1.06e-11 65 33 4 135 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas campestris pv. campestris (strain 8004)
B0CIU0 1.14e-11 65 28 5 176 3 gloB Hydroxyacylglutathione hydrolase Brucella suis (strain ATCC 23445 / NCTC 10510)
C0RFI1 1.14e-11 65 28 5 176 3 gloB Hydroxyacylglutathione hydrolase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M8S2 1.14e-11 65 28 5 176 3 gloB Hydroxyacylglutathione hydrolase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
B2S889 1.14e-11 65 28 5 176 3 gloB Hydroxyacylglutathione hydrolase Brucella abortus (strain S19)
Q10Y41 1.18e-11 65 28 8 230 3 gloB Hydroxyacylglutathione hydrolase Trichodesmium erythraeum (strain IMS101)
O24495 1.2e-11 66 28 5 172 2 GLX2-1 Hydroxyacylglutathione hydrolase 1, mitochondrial Arabidopsis thaliana
B0UBD0 1.24e-11 65 28 6 231 3 gloB Hydroxyacylglutathione hydrolase Methylobacterium sp. (strain 4-46)
B1WUT9 1.25e-11 65 27 8 234 3 gloB Hydroxyacylglutathione hydrolase Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q0BMS2 1.86e-11 65 24 6 215 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A4E2 1.86e-11 65 24 6 215 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. holarctica (strain LVS)
A7NB16 1.86e-11 65 24 6 215 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A4IWV0 1.88e-11 64 24 6 215 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NF43 1.88e-11 64 24 6 215 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
B2SFR3 1.88e-11 64 24 6 215 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14GJ6 1.88e-11 64 24 6 215 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. tularensis (strain FSC 198)
Q493H8 2.13e-11 64 30 5 146 3 gloB Hydroxyacylglutathione hydrolase Blochmanniella pennsylvanica (strain BPEN)
B6EJV4 2.18e-11 64 27 7 189 3 gloB Hydroxyacylglutathione hydrolase Aliivibrio salmonicida (strain LFI1238)
Q87YS8 2.22e-11 64 25 7 250 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q1QQZ1 3.14e-11 64 30 4 159 3 gloB Hydroxyacylglutathione hydrolase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A0KIK2 3.17e-11 64 33 6 160 3 gloB Hydroxyacylglutathione hydrolase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q3SVQ1 3.34e-11 64 27 4 192 3 gloB Hydroxyacylglutathione hydrolase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q07VA9 3.54e-11 64 31 5 152 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain BisA53)
Q7N809 4.58e-11 63 30 7 190 3 gloB Hydroxyacylglutathione hydrolase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6VNK4 6.19e-11 63 27 8 209 3 gloB Hydroxyacylglutathione hydrolase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q6G1L3 6.41e-11 63 25 5 224 3 gloB Hydroxyacylglutathione hydrolase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
C5BEP2 7.29e-11 63 29 7 166 3 gloB Hydroxyacylglutathione hydrolase Edwardsiella ictaluri (strain 93-146)
Q3JRV4 7.91e-11 63 27 7 205 1 BURPS1710b_2304 Probable metallo-hydrolase BURPS1710b_2304 Burkholderia pseudomallei (strain 1710b)
Q7NG34 8.62e-11 63 30 3 154 3 gloB Hydroxyacylglutathione hydrolase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B0JW10 9.98e-11 62 33 6 150 3 gloB Hydroxyacylglutathione hydrolase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q1QW62 1.04e-10 62 28 9 247 3 gloB Hydroxyacylglutathione hydrolase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q5LNN5 1.08e-10 62 28 5 193 3 gloB Hydroxyacylglutathione hydrolase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5E3G3 1.47e-10 62 27 7 186 3 gloB Hydroxyacylglutathione hydrolase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5F9V3 1.61e-10 62 27 7 186 3 gloB Hydroxyacylglutathione hydrolase Aliivibrio fischeri (strain MJ11)
B7KEB4 1.77e-10 62 29 7 173 3 gloB Hydroxyacylglutathione hydrolase Gloeothece citriformis (strain PCC 7424)
Q8YZ99 1.8e-10 62 26 9 253 3 gloB Hydroxyacylglutathione hydrolase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q6FYC3 1.81e-10 62 25 6 220 3 gloB Hydroxyacylglutathione hydrolase Bartonella quintana (strain Toulouse)
Q31H51 1.81e-10 62 33 8 171 3 gloB Hydroxyacylglutathione hydrolase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A7Z4X7 1.96e-10 61 24 6 215 1 baeB Probable polyketide biosynthesis zinc-dependent hydrolase BaeB Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q5N5S6 2.05e-10 62 29 6 178 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31ND6 2.05e-10 62 29 6 178 3 gloB Hydroxyacylglutathione hydrolase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B7VIP5 2.29e-10 62 29 5 158 3 gloB Hydroxyacylglutathione hydrolase Vibrio atlanticus (strain LGP32)
A6WXE0 2.93e-10 61 29 4 151 3 gloB Hydroxyacylglutathione hydrolase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A8AKR2 4.09e-10 61 30 8 193 3 gloB Hydroxyacylglutathione hydrolase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B0U365 4.36e-10 61 29 4 158 3 gloB Hydroxyacylglutathione hydrolase Xylella fastidiosa (strain M12)
O34910 4.47e-10 60 29 6 161 3 yobT Uncharacterized protein YobT Bacillus subtilis (strain 168)
Q87C74 4.9e-10 60 29 4 158 3 gloB Hydroxyacylglutathione hydrolase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I5S5 4.9e-10 60 29 4 158 3 gloB Hydroxyacylglutathione hydrolase Xylella fastidiosa (strain M23)
Q1I7T2 4.99e-10 60 30 10 247 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas entomophila (strain L48)
A0KXS9 5.32e-10 60 30 9 167 3 gloB Hydroxyacylglutathione hydrolase Shewanella sp. (strain ANA-3)
A5W167 5.5e-10 60 31 3 160 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q9PBI4 6.02e-10 60 28 4 158 3 gloB Hydroxyacylglutathione hydrolase Xylella fastidiosa (strain 9a5c)
A3QET2 6.24e-10 60 31 8 161 3 gloB Hydroxyacylglutathione hydrolase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B0KN02 6.96e-10 60 31 3 160 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas putida (strain GB-1)
Q0AM20 7.94e-10 60 27 5 172 3 gloB Hydroxyacylglutathione hydrolase Maricaulis maris (strain MCS10)
Q7U5Z8 8.08e-10 60 28 6 185 3 gloB Hydroxyacylglutathione hydrolase Parasynechococcus marenigrum (strain WH8102)
Q47FN7 8.45e-10 60 33 5 137 3 gloB Hydroxyacylglutathione hydrolase Dechloromonas aromatica (strain RCB)
A6WMW5 9.73e-10 60 32 10 182 3 gloB Hydroxyacylglutathione hydrolase Shewanella baltica (strain OS185)
Q6LN63 9.9e-10 60 27 9 250 3 gloB Hydroxyacylglutathione hydrolase Photobacterium profundum (strain SS9)
Q6P963 9.9e-10 60 26 8 198 2 hagh Hydroxyacylglutathione hydrolase, mitochondrial Danio rerio
Q88FF3 1.11e-09 60 30 3 160 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q3MGD2 1.26e-09 59 25 9 253 3 gloB Hydroxyacylglutathione hydrolase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q2SJ47 1.5e-09 59 29 12 252 3 gloB Hydroxyacylglutathione hydrolase Hahella chejuensis (strain KCTC 2396)
Q2P6Y4 1.58e-09 59 29 4 157 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q82XW0 1.8e-09 59 28 12 249 3 gloB Hydroxyacylglutathione hydrolase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B2IVH7 1.8e-09 59 26 7 197 3 gloB Hydroxyacylglutathione hydrolase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A1S6T3 1.83e-09 59 28 7 190 3 gloB Hydroxyacylglutathione hydrolase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q54EJ5 1.83e-09 59 25 8 223 3 gloB2 Glyoxylase B2 Dictyostelium discoideum
Q12BV7 2.2e-09 59 29 7 179 3 gloB Hydroxyacylglutathione hydrolase Polaromonas sp. (strain JS666 / ATCC BAA-500)
A6V707 2.36e-09 58 31 5 174 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas aeruginosa (strain PA7)
Q1LT01 2.39e-09 58 27 4 157 3 gloB Hydroxyacylglutathione hydrolase Baumannia cicadellinicola subsp. Homalodisca coagulata
P05446 2.47e-09 58 25 7 248 3 gloB Hydroxyacylglutathione hydrolase Fuscovulum blasticum
Q0A751 2.54e-09 58 32 10 190 3 gloB Hydroxyacylglutathione hydrolase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q3AYI2 2.77e-09 58 24 10 251 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain CC9902)
Q5ZI23 2.99e-09 59 24 7 198 2 HAGH Hydroxyacylglutathione hydrolase, mitochondrial Gallus gallus
B2FR57 3.1e-09 58 31 7 178 3 gloB Hydroxyacylglutathione hydrolase Stenotrophomonas maltophilia (strain K279a)
B0BZI8 3.26e-09 58 28 5 165 3 gloB Hydroxyacylglutathione hydrolase Acaryochloris marina (strain MBIC 11017)
A3D437 3.62e-09 58 31 10 182 3 gloB Hydroxyacylglutathione hydrolase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E5A2 4.11e-09 58 33 10 169 3 gloB Hydroxyacylglutathione hydrolase Shewanella baltica (strain OS223)
B4F6K2 4.56e-09 58 25 8 198 2 hagh Hydroxyacylglutathione hydrolase, mitochondrial Xenopus tropicalis
Q3BWP5 4.65e-09 58 27 3 157 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q1RFX9 5.37e-09 57 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain UTI89 / UPEC)
Q89AN4 5.44e-09 57 24 5 158 3 gloB Hydroxyacylglutathione hydrolase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1A7Q3 5.53e-09 57 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O1:K1 / APEC
B7MBI8 5.53e-09 57 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O45:K1 (strain S88 / ExPEC)
P71374 6.38e-09 57 28 7 182 3 gloB Hydroxyacylglutathione hydrolase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q2K3M6 6.92e-09 57 27 6 226 3 gloB Hydroxyacylglutathione hydrolase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B1XQ70 7.35e-09 57 28 6 164 3 gloB Hydroxyacylglutathione hydrolase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A2C116 8.33e-09 57 26 9 195 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain NATL1A)
A9L0E9 8.49e-09 57 36 8 137 3 gloB Hydroxyacylglutathione hydrolase Shewanella baltica (strain OS195)
B7VB64 8.61e-09 57 31 5 174 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas aeruginosa (strain LESB58)
Q46GM1 8.91e-09 57 26 9 195 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain NATL2A)
P0AC84 8.91e-09 57 31 8 193 1 gloB Hydroxyacylglutathione hydrolase GloB Escherichia coli (strain K12)
B1XD76 8.91e-09 57 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain K12 / DH10B)
C4ZRU9 8.91e-09 57 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain K12 / MC4100 / BW2952)
B5Z0I6 8.91e-09 57 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AC85 8.91e-09 57 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O157:H7
Q16775 8.98e-09 57 26 8 199 1 HAGH Hydroxyacylglutathione hydrolase, mitochondrial Homo sapiens
Q3JAC4 9.09e-09 57 25 6 191 3 gloB Hydroxyacylglutathione hydrolase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
C3K9Q0 9.19e-09 57 30 6 190 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas fluorescens (strain SBW25)
Q7VD23 9.23e-09 57 29 6 171 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q32JQ1 9.27e-09 57 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Shigella dysenteriae serotype 1 (strain Sd197)
Q9I2T1 9.39e-09 57 31 5 174 1 gloB Hydroxyacylglutathione hydrolase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A7ZWF4 9.54e-09 57 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O9:H4 (strain HS)
B0BTR9 9.55e-09 57 27 8 180 3 gloB Hydroxyacylglutathione hydrolase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H0S9 9.55e-09 57 27 8 180 3 gloB Hydroxyacylglutathione hydrolase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q2N9P7 9.63e-09 57 28 3 140 3 gloB Hydroxyacylglutathione hydrolase Erythrobacter litoralis (strain HTCC2594)
Q3SIB0 1e-08 57 29 5 159 3 gloB Hydroxyacylglutathione hydrolase Thiobacillus denitrificans (strain ATCC 25259)
P37502 1.06e-08 56 33 2 107 3 yybB Probable metallo-hydrolase YybB Bacillus subtilis (strain 168)
Q0TLC5 1.11e-08 57 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UJA8 1.11e-08 57 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q4KBH9 1.19e-08 57 31 5 173 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B2VHJ7 1.31e-08 57 29 7 178 3 gloB Hydroxyacylglutathione hydrolase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B7MQ21 1.34e-08 57 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O81 (strain ED1a)
B6HZS5 1.68e-08 56 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain SE11)
B1IPU6 1.78e-08 56 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q83MC1 1.79e-08 56 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Shigella flexneri
Q0T802 1.79e-08 56 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Shigella flexneri serotype 5b (strain 8401)
Q325T4 1.79e-08 56 31 8 193 3 gloB Hydroxyacylglutathione hydrolase Shigella boydii serotype 4 (strain Sb227)
A9BEI3 1.82e-08 56 27 7 170 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9211)
A5GJK5 1.88e-08 56 26 7 195 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain WH7803)
Q5F336 1.89e-08 56 26 8 199 2 MBLAC2 Acyl-coenzyme A thioesterase MBLAC2 Gallus gallus
Q28333 1.92e-08 56 28 10 200 2 HAGH Hydroxyacylglutathione hydrolase, mitochondrial (Fragment) Callithrix jacchus
Q28TK3 1.93e-08 56 27 7 248 3 gloB Hydroxyacylglutathione hydrolase Jannaschia sp. (strain CCS1)
Q8PNI0 2e-08 56 27 4 157 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas axonopodis pv. citri (strain 306)
Q3AL08 2e-08 56 25 8 235 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain CC9605)
P72933 2.08e-08 56 26 9 235 3 gloB Hydroxyacylglutathione hydrolase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q0AE32 2.11e-08 56 26 10 249 3 gloB Hydroxyacylglutathione hydrolase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q4R6C1 2.35e-08 56 26 8 199 2 HAGH Hydroxyacylglutathione hydrolase, mitochondrial Macaca fascicularis
A5UF43 2.46e-08 55 28 7 182 3 gloB Hydroxyacylglutathione hydrolase Haemophilus influenzae (strain PittGG)
A1U0V1 2.53e-08 56 29 8 165 3 gloB Hydroxyacylglutathione hydrolase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
O24496 2.97e-08 55 27 8 195 1 GLX2-2 Hydroxyacylglutathione hydrolase cytoplasmic Arabidopsis thaliana
A3MZD3 3.02e-08 55 27 8 180 3 gloB Hydroxyacylglutathione hydrolase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B8HMJ9 3.13e-08 55 32 3 118 3 gloB Hydroxyacylglutathione hydrolase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
B1LHM1 3.4e-08 55 30 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain SMS-3-5 / SECEC)
B7NKW6 3.4e-08 55 30 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7M211 3.43e-08 55 30 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O8 (strain IAI1)
B7LHB8 3.43e-08 55 30 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain 55989 / EAEC)
Q3Z5F1 3.5e-08 55 30 8 193 3 gloB Hydroxyacylglutathione hydrolase Shigella sonnei (strain Ss046)
B2U350 3.5e-08 55 30 8 193 3 gloB Hydroxyacylglutathione hydrolase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A7ZHU8 3.5e-08 55 30 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LW87 5.25e-08 55 30 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q6NYF0 6.14e-08 55 27 10 176 2 lactb2 Endoribonuclease LACTB2 Danio rerio
Q5XGR8 6.38e-08 55 29 7 160 2 lactb2 Endoribonuclease LACTB2 Xenopus laevis
O34409 6.92e-08 55 29 4 134 2 yflN Probable metallo-hydrolase YflN Bacillus subtilis (strain 168)
Q8EE27 1e-07 54 29 8 165 3 gloB Hydroxyacylglutathione hydrolase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7VM19 1.09e-07 53 23 9 226 3 gloB Hydroxyacylglutathione hydrolase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q05584 1.09e-07 54 25 9 212 1 GLO2 Hydroxyacylglutathione hydrolase, cytoplasmic isozyme Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q0I8S8 1.16e-07 54 24 6 180 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain CC9311)
A4WUN2 1.22e-07 53 28 3 192 3 gloB Hydroxyacylglutathione hydrolase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q8FKY7 1.23e-07 53 30 8 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q051W5 2e-07 53 27 8 191 3 gloB Hydroxyacylglutathione hydrolase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04RQ6 2e-07 53 27 8 191 3 gloB Hydroxyacylglutathione hydrolase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q3J436 2.22e-07 53 26 4 193 3 gloB Hydroxyacylglutathione hydrolase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q8ZRM2 2.31e-07 53 29 7 195 1 gloB Hydroxyacylglutathione hydrolase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q68D91 2.4e-07 53 28 7 163 1 MBLAC2 Acyl-coenzyme A thioesterase MBLAC2 Homo sapiens
A3PIB4 2.42e-07 53 26 4 193 3 gloB Hydroxyacylglutathione hydrolase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q4QJZ3 2.56e-07 53 27 7 168 3 gloB Hydroxyacylglutathione hydrolase Haemophilus influenzae (strain 86-028NP)
A5PJT0 2.57e-07 53 28 7 163 2 MBLAC2 Acyl-coenzyme A thioesterase MBLAC2 Bos taurus
B7N874 2.97e-07 53 29 7 193 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q0V9A9 3.09e-07 53 26 10 193 2 lactb2 Endoribonuclease LACTB2 Xenopus tropicalis
Q7V6G8 3.45e-07 52 25 8 178 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9313)
B5BDW7 3.77e-07 52 29 7 195 3 gloB Hydroxyacylglutathione hydrolase Salmonella paratyphi A (strain AKU_12601)
Q5PFD6 3.77e-07 52 29 7 195 3 gloB Hydroxyacylglutathione hydrolase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B0UU01 4.04e-07 52 25 8 197 3 gloB Hydroxyacylglutathione hydrolase Histophilus somni (strain 2336)
B5R447 4.36e-07 52 29 7 195 3 gloB Hydroxyacylglutathione hydrolase Salmonella enteritidis PT4 (strain P125109)
B5FJ56 4.36e-07 52 29 7 195 3 gloB Hydroxyacylglutathione hydrolase Salmonella dublin (strain CT_02021853)
Q0I3Q7 5.19e-07 52 25 8 197 3 gloB Hydroxyacylglutathione hydrolase Histophilus somni (strain 129Pt)
A9MPF3 5.23e-07 52 29 7 193 3 gloB Hydroxyacylglutathione hydrolase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B0TRL8 6.28e-07 52 29 11 196 3 gloB Hydroxyacylglutathione hydrolase Shewanella halifaxensis (strain HAW-EB4)
Q3KE79 6.36e-07 52 31 5 173 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas fluorescens (strain Pf0-1)
Q2IJC6 6.6e-07 52 31 5 167 3 gloB Hydroxyacylglutathione hydrolase Anaeromyxobacter dehalogenans (strain 2CP-C)
B4TYG8 7.66e-07 51 29 7 195 3 gloB Hydroxyacylglutathione hydrolase Salmonella schwarzengrund (strain CVM19633)
A9MZ21 7.66e-07 51 29 7 195 3 gloB Hydroxyacylglutathione hydrolase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SV37 7.66e-07 51 29 7 195 3 gloB Hydroxyacylglutathione hydrolase Salmonella newport (strain SL254)
B4TK83 7.66e-07 51 29 7 195 3 gloB Hydroxyacylglutathione hydrolase Salmonella heidelberg (strain SL476)
Q57SZ8 7.66e-07 51 29 7 195 3 gloB Hydroxyacylglutathione hydrolase Salmonella choleraesuis (strain SC-B67)
B5F8X0 7.66e-07 51 29 7 195 3 gloB Hydroxyacylglutathione hydrolase Salmonella agona (strain SL483)
B5R5L1 7.96e-07 51 29 7 195 3 gloB Hydroxyacylglutathione hydrolase Salmonella gallinarum (strain 287/91 / NCTC 13346)
C0Q6N0 8.27e-07 51 29 7 195 3 gloB Hydroxyacylglutathione hydrolase Salmonella paratyphi C (strain RKS4594)
Q1MB56 1.11e-06 51 27 7 231 3 gloB Hydroxyacylglutathione hydrolase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q65U07 1.39e-06 50 24 7 189 3 gloB Hydroxyacylglutathione hydrolase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q21J46 1.44e-06 51 28 7 158 3 gloB Hydroxyacylglutathione hydrolase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q8D3D4 1.86e-06 50 30 6 177 3 gloB Hydroxyacylglutathione hydrolase Wigglesworthia glossinidia brevipalpis
Q8BL86 2.49e-06 50 27 7 163 1 Mblac2 Acyl-coenzyme A thioesterase MBLAC2 Mus musculus
C4LC58 2.54e-06 50 29 10 196 3 gloB Hydroxyacylglutathione hydrolase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B8F6A3 2.85e-06 50 24 11 244 3 gloB Hydroxyacylglutathione hydrolase Glaesserella parasuis serovar 5 (strain SH0165)
A5FZE9 3.6e-06 49 29 2 115 3 gloB Hydroxyacylglutathione hydrolase Acidiphilium cryptum (strain JF-5)
Q53H82 9.5e-06 48 28 7 149 1 LACTB2 Endoribonuclease LACTB2 Homo sapiens
A2C7W3 9.85e-06 48 25 6 158 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9303)
Q0BWR4 1.2e-05 48 26 2 127 3 gloB Hydroxyacylglutathione hydrolase Hyphomonas neptunium (strain ATCC 15444)
Q561R9 1.23e-05 48 27 7 149 2 Lactb2 Endoribonuclease LACTB2 Rattus norvegicus
Q5F7J0 1.26e-05 48 26 11 242 3 gloB Hydroxyacylglutathione hydrolase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B4RJC7 1.4e-05 48 25 9 245 3 gloB Hydroxyacylglutathione hydrolase Neisseria gonorrhoeae (strain NCCP11945)
Q99KR3 3.79e-05 47 26 5 151 1 Lactb2 Endoribonuclease LACTB2 Mus musculus
Q6PII5 4.55e-05 46 24 5 182 1 HAGHL Hydroxyacylglutathione hydrolase-like protein Homo sapiens
Q162S3 6.45e-05 46 24 9 250 3 gloB Hydroxyacylglutathione hydrolase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A8GA75 8.49e-05 45 27 4 157 3 gloB Hydroxyacylglutathione hydrolase Serratia proteamaculans (strain 568)
Q9DB32 0.0002 44 25 6 182 1 Haghl Hydroxyacylglutathione hydrolase-like protein Mus musculus
A0A5B8YUX5 0.000212 44 26 5 144 2 GME11357 Lactamase-like protein GME11357 Pestalotiopsis microspora
Q12MM2 0.000236 44 28 6 162 3 gloB Hydroxyacylglutathione hydrolase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A8H589 0.000284 44 24 11 252 3 gloB Hydroxyacylglutathione hydrolase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q9VLS9 0.000455 43 29 10 176 2 CG12375 Beta-lactamase-like protein 2 homolog Drosophila melanogaster
M3ANL0 0.000572 43 25 4 135 2 MYCFIDRAFT_190111 Atrochrysone carboxyl ACP thioesterase MYCFIDRAFT_190111 Pseudocercospora fijiensis (strain CIRAD86)
D7PHZ8 0.000582 43 27 4 137 1 vrtG Lactamase-like protein vrtG Penicillium aethiopicum
E1ACR1 0.000789 43 27 5 136 1 notP Lactamase-like protein notP Aspergillus sp. (strain MF297-2)
Q54MR1 0.001 42 25 7 148 3 hagh Hydroxyacylglutathione hydrolase Dictyostelium discoideum
A0A411PQM3 0.001 42 25 5 155 3 AgnL7 Atrochrysone carboxyl ACP thioesterase AgnL7 Paecilomyces divaricatus

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01430
Feature type CDS
Gene -
Product MBL fold metallo-hydrolase
Location 314751 - 315398 (strand: 1)
Length 648 (nucleotides) / 215 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1304
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00753 Metallo-beta-lactamase superfamily

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0491 General function prediction only (R) R Glyoxylase or a related metal-dependent hydrolase, beta-lactamase superfamily II

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01069 hydroxyacylglutathione hydrolase [EC:3.1.2.6] Pyruvate metabolism
Metabolic pathways
-

Protein Sequence

MQYQIIPVTGFMQNCTLIWCDETKAAAIVDPGGEAPRLIREIEQRGLKLEKILLTHGHFDHVGATADVAEHFHVPVIGPQKDDEFWIEGLVSQSQMFGVEPCRAFTPDQWLEEGDKVTVGNIELDVLHCPGHTPGHVVFVNKQDKLISMGDVLFKGGVGRSDFPKGNHQDLIRSIKEKILPLGDDYRFIPGHGPMSTLGDERRTNPFLQDEQPVW

Flanking regions ( +/- flanking 50bp)

AGAACGTGGTAATCTGCTGTAATTGTCAGATTTAACCGGAGTTTTGTGTCATGCAATATCAAATTATTCCTGTCACCGGCTTTATGCAAAATTGTACCCTGATTTGGTGCGATGAAACGAAAGCCGCTGCTATTGTCGACCCCGGCGGTGAAGCGCCGCGTCTTATCCGTGAAATTGAACAGCGCGGACTGAAATTAGAAAAAATCCTTCTTACTCATGGTCATTTTGATCACGTTGGCGCAACCGCTGATGTGGCAGAGCATTTTCATGTGCCGGTGATTGGTCCTCAGAAAGACGATGAATTCTGGATTGAAGGGCTTGTATCACAAAGCCAGATGTTTGGAGTAGAGCCATGCCGTGCATTTACGCCGGATCAATGGCTGGAAGAAGGGGATAAAGTCACTGTCGGTAATATTGAGCTTGATGTTCTGCACTGTCCCGGACATACCCCGGGGCACGTAGTTTTCGTGAATAAGCAGGACAAACTGATTTCGATGGGTGATGTTTTATTTAAAGGCGGCGTCGGGCGCAGTGATTTCCCTAAAGGTAATCATCAGGATCTCATCCGTTCAATTAAAGAAAAAATCTTACCGCTGGGTGATGATTATCGCTTTATACCCGGTCACGGACCGATGTCCACACTCGGTGATGAGCGCCGTACTAATCCGTTTTTACAAGATGAACAACCGGTCTGGTGATCGTTCAACTGAAATAGTCCAACCAGAAATAGCCGCAAATAAAAAAGCCT