Homologs in group_1300

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07225 FBDBKF_07225 96.4 Morganella morganii S1 pncA Nicotinamidase-related amidase
EHELCC_03745 EHELCC_03745 96.4 Morganella morganii S2 pncA Nicotinamidase-related amidase
NLDBIP_03745 NLDBIP_03745 96.4 Morganella morganii S4 pncA Nicotinamidase-related amidase
LHKJJB_09575 LHKJJB_09575 96.4 Morganella morganii S3 pncA Nicotinamidase-related amidase
HKOGLL_09400 HKOGLL_09400 96.4 Morganella morganii S5 pncA Nicotinamidase-related amidase
PMI_RS10855 PMI_RS10855 92.0 Proteus mirabilis HI4320 - hydrolase

Distribution of the homologs in the orthogroup group_1300

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1300

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P21367 2.92e-55 178 44 1 196 1 ycaC Probable hydrolase YcaC Escherichia coli (strain K12)
Q5U3Z3 4.18e-10 60 26 4 192 2 Isoc2 Isochorismatase domain-containing protein 2 Rattus norvegicus
Q9DCC7 1.98e-08 56 25 4 177 1 Isoc2b Isochorismatase domain-containing protein 2B Mus musculus
P85094 2.73e-07 52 24 5 194 1 Isoc2a Isochorismatase domain-containing protein 2A Mus musculus
Q9FMX7 7.46e-07 51 26 4 165 1 NIC2 Nicotinamidase 2 Arabidopsis thaliana
Q32KX0 1.42e-05 47 24 7 165 2 ISOC2 Isochorismatase domain-containing protein 2 Bos taurus
A0JME6 1.74e-05 47 24 5 179 2 isoc2 Isochorismatase domain-containing protein 2 Danio rerio
Q6DF67 2.25e-05 47 23 5 174 2 isoc2 Isochorismatase domain-containing protein 2 Xenopus tropicalis
Q91V64 0.000113 45 26 3 146 1 Isoc1 Isochorismatase domain-containing protein 1 Mus musculus
Q96CN7 0.000121 45 26 3 146 1 ISOC1 Isochorismatase domain-containing protein 1 Homo sapiens
A6QLY4 0.000124 45 26 3 146 2 ISOC1 Isochorismatase domain-containing protein 1 Bos taurus
Q6I7R3 0.000143 45 26 3 146 1 Isoc1 Isochorismatase domain-containing protein 1 Rattus norvegicus
Q5PQA5 0.000178 45 23 2 145 2 isoc1 Isochorismatase domain-containing protein 1 Xenopus laevis
Q08C33 0.000217 45 24 4 142 2 isoc1 Isochorismatase domain-containing protein 1 Danio rerio
P74965 0.000239 44 25 4 181 3 venB Probable isochorismatase Vibrio vulnificus (strain CMCP6)
Q54NZ6 0.00031 43 22 7 193 3 DDB_G0285041 Isochorismatase family protein 1A Dictyostelium discoideum
Q51790 0.000388 43 24 4 170 1 phzD Phenazine biosynthesis protein PhzD Pseudomonas fluorescens
Q0IHU5 0.000592 43 23 3 146 2 isoc1 Isochorismatase domain-containing protein 1 Xenopus tropicalis
B5X0W9 0.000807 43 23 3 142 2 isoc1 Isochorismatase domain-containing protein 1 Salmo salar
Q51518 0.001 42 24 5 176 3 phzA Probable isochorismatase Pseudomonas chlororaphis

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01410
Feature type CDS
Gene -
Product hydrolase
Location 310043 - 310720 (strand: -1)
Length 678 (nucleotides) / 225 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1300
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00857 Isochorismatase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1335 Coenzyme transport and metabolism (H)
General function prediction only (R)		 HR Nicotinamidase-related amidase

Protein Sequence

MSNPANFNGQRPVINPDDALMLLIDHQSGLFQTVGDMPMTELRARAAVLAKMATLAGIPVITTASVPQGPNGPLIPEIHQNAPHAQYIARKGEINAWDNPEFVAAVKASGKKQLIIAGTITSVCMAFPAISAVADGYQVFAVIDASGTYTKMAQEITLARVVQAGVVPMDTAAVASELQKTWNRPDAAEWAQAYTQIFPAYQLLIESYSKAQEVIINNEVPDSQR

Flanking regions ( +/- flanking 50bp)

TCCGGACAAACAAGAATAACTGTCTCTTTATCTAATATAAGGATCTTAAAATGAGTAACCCTGCAAATTTCAACGGTCAGCGTCCTGTTATTAATCCTGATGATGCACTGATGCTGTTAATTGATCACCAGAGCGGATTGTTCCAGACCGTTGGTGATATGCCGATGACTGAATTACGCGCACGTGCTGCTGTTCTGGCAAAAATGGCCACTCTGGCCGGTATTCCGGTGATCACCACTGCATCCGTGCCACAAGGCCCTAATGGCCCGCTTATCCCGGAAATTCACCAGAATGCTCCGCATGCTCAATATATTGCCCGCAAAGGTGAGATTAATGCGTGGGATAACCCGGAATTTGTGGCAGCGGTAAAAGCCTCCGGTAAAAAACAACTTATTATTGCCGGAACGATTACCAGCGTATGTATGGCTTTCCCTGCTATCAGTGCTGTCGCAGACGGCTATCAGGTTTTCGCGGTGATTGATGCATCCGGTACCTATACCAAAATGGCACAGGAAATCACTCTCGCACGCGTTGTTCAGGCAGGTGTCGTTCCTATGGATACCGCCGCTGTCGCTTCTGAGCTGCAAAAAACCTGGAATCGCCCGGATGCGGCTGAATGGGCACAAGCTTATACACAAATCTTTCCCGCATATCAGTTACTGATTGAAAGCTACAGCAAGGCGCAGGAAGTGATTATCAATAATGAAGTACCTGATTCACAGCGCTGATAAAAAAACGGATGGGCATAATGTATGCGCATCCGTCTTCAGTAAAAAAA