Homologs in group_2574

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02770 FBDBKF_02770 34.6 Morganella morganii S1 pip prolyl aminopeptidase
EHELCC_03240 EHELCC_03240 34.6 Morganella morganii S2 pip prolyl aminopeptidase
NLDBIP_00220 NLDBIP_00220 34.6 Morganella morganii S4 pip prolyl aminopeptidase
LHKJJB_01815 LHKJJB_01815 34.6 Morganella morganii S3 pip prolyl aminopeptidase
HKOGLL_01855 HKOGLL_01855 34.6 Morganella morganii S5 pip prolyl aminopeptidase

Distribution of the homologs in the orthogroup group_2574

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2574

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O05235 5.83e-12 67 23 6 268 3 yugF Uncharacterized hydrolase YugF Bacillus subtilis (strain 168)
Q6DRD9 1.95e-11 66 36 2 107 2 abhd11 sn-1-specific diacylglycerol lipase ABHD11 Danio rerio
P22862 5.25e-11 64 27 9 229 1 estF Arylesterase Pseudomonas fluorescens
Q3SZ73 1.33e-10 63 32 1 103 1 ABHD11 sn-1-specific diacylglycerol lipase ABHD11 Bos taurus
O06734 2.1e-10 62 25 8 251 3 yisY AB hydrolase superfamily protein YisY Bacillus subtilis (strain 168)
O83041 8.27e-10 61 35 3 110 3 pip Probable proline iminopeptidase Leptolyngbya boryana
P23974 8.71e-10 61 26 11 264 3 menH Putative 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Bacillus subtilis (strain 168)
Q8K4F5 1.57e-09 60 25 7 258 1 Abhd11 sn-1-specific diacylglycerol lipase ABHD11 Mus musculus
Q8NFV4 1.98e-09 60 31 1 103 1 ABHD11 sn-1-specific diacylglycerol lipase ABHD11 Homo sapiens
P52279 5.55e-09 59 32 2 125 1 pip Proline iminopeptidase Xanthomonas citri
Q9PD69 1.71e-08 57 27 5 179 3 pip Proline iminopeptidase Xylella fastidiosa (strain 9a5c)
O05691 1.98e-08 57 28 9 221 3 thcF Non-heme haloperoxidase Rhodococcus erythropolis
Q9S2L4 2.51e-08 57 31 3 132 3 SCO1989 Probable proline iminopeptidase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O31158 2.68e-08 57 25 11 249 1 cpo Non-heme chloroperoxidase Pseudomonas fluorescens
C5CN82 2.75e-08 56 25 6 255 3 rutD Putative carbamate hydrolase RutD Variovorax paradoxus (strain S110)
P07383 3e-08 56 22 7 269 1 None Tropinesterase Pseudomonas putida
B1MFK2 4.67e-08 56 32 3 116 1 aqdC 2-heptyl-3-hydroxy-4(1H)-quinolone dioxygenase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q57427 5.23e-08 56 24 4 232 3 HI_0193 Putative esterase/lipase HI_0193 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q2TAP9 6.55e-08 55 31 1 103 2 abhd11 sn-1-specific diacylglycerol lipase ABHD11 Xenopus laevis
P49323 6.72e-08 55 30 4 156 1 cpo Non-heme chloroperoxidase Streptomyces lividans
B0SW62 7.73e-08 55 26 15 275 3 rutD Putative carbamate hydrolase RutD Caulobacter sp. (strain K31)
Q0V9K2 8.56e-08 55 31 1 103 2 abhd11 sn-1-specific diacylglycerol lipase ABHD11 Xenopus tropicalis
Q87DF8 1.04e-07 55 27 5 179 3 pip Proline iminopeptidase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P93732 1.35e-07 55 32 2 125 2 PIP Proline iminopeptidase Arabidopsis thaliana
P26174 2.61e-07 53 37 3 105 3 bchO Magnesium-chelatase 30 kDa subunit Rhodobacter capsulatus
Q9JUV1 3.81e-07 53 32 3 128 3 pip Proline iminopeptidase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JZR6 3.88e-07 53 32 3 128 3 pip Proline iminopeptidase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
O32449 5.45e-07 53 31 2 125 1 pip Proline iminopeptidase Serratia marcescens
P42786 6.65e-07 52 32 3 128 1 pip Proline iminopeptidase Neisseria gonorrhoeae
O31581 8.86e-07 52 22 8 288 3 yfhM AB hydrolase superfamily protein YfhM Bacillus subtilis (strain 168)
W3XA95 1.05e-06 52 22 7 271 3 PfmaB Proline iminopeptidase PfmaB Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
P75092 1.82e-06 51 30 2 120 3 pip Putative proline iminopeptidase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q83WC8 2.19e-06 51 25 9 256 1 dch Bifunctional esterase/perhydrolase DCH Acinetobacter calcoaceticus
B1M5I5 3e-06 50 32 5 124 3 rutD Putative carbamate hydrolase RutD Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B7KWT4 5.23e-06 50 29 4 157 3 rutD Putative carbamate hydrolase RutD Methylorubrum extorquens (strain CM4 / NCIMB 13688)
P47266 1.82e-05 48 29 2 119 3 pip Putative proline iminopeptidase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
A4JPX5 2.2e-05 48 25 13 274 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Burkholderia vietnamiensis (strain G4 / LMG 22486)
O94437 2.92e-05 47 31 3 117 3 SPAC22H12.03 Abhydrolase domain-containing protein C22H12.03 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q2Y9Y7 2.99e-05 47 24 10 252 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q8IUS5 3.34e-05 48 26 2 118 1 EPHX4 Epoxide hydrolase 4 Homo sapiens
P25026 3.59e-05 47 23 7 228 1 cpo Non-heme chloroperoxidase Burkholderia pyrrocinia
A0A0E4AE82 4.42e-05 47 27 5 147 1 aqdC2 2-heptyl-3-hydroxy-4-quinolone dioxygenase AqdC2 Rhodococcus erythropolis
A8GCT3 4.79e-05 47 31 4 112 3 rutD Putative carbamate hydrolase RutD Serratia proteamaculans (strain 568)
Q49418 5.58e-05 47 22 10 265 3 MG327 Putative esterase/lipase 2 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
I6YC03 6.85e-05 47 27 3 122 1 ephB Epoxide hydrolase B Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P95276 6.85e-05 47 27 3 122 1 MT1988 Epoxide hydrolase B Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
C7CM33 7.3e-05 46 28 4 157 3 rutD Putative carbamate hydrolase RutD Methylorubrum extorquens (strain DSM 6343 / CIP 106787 / DM4)
Q6IE26 8.49e-05 46 25 2 118 2 Ephx4 Epoxide hydrolase 4 Mus musculus
Q4R584 9.21e-05 46 24 8 249 2 ABHD8 Protein ABHD8 Macaca fascicularis
Q96I13 9.8e-05 46 24 8 249 1 ABHD8 Protein ABHD8 Homo sapiens
D5VGV3 0.000108 46 28 7 140 3 rutD Putative carbamate hydrolase RutD Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059)
Q0IIS3 0.00011 46 24 2 120 2 ephx3 Epoxide hydrolase 3 Xenopus tropicalis
Q6Q2C2 0.00012 46 25 2 123 2 EPHX2 Bifunctional epoxide hydrolase 2 Sus scrofa
Q17QP1 0.000136 46 23 8 249 2 ABHD8 Protein ABHD8 Bos taurus
O31168 0.000182 45 30 3 112 1 cpo Non-heme chloroperoxidase Kitasatospora aureofaciens
O64252 0.000224 45 33 1 87 3 59.2 Putative non-heme haloperoxidase Mycobacterium phage D29
B2JQW2 0.000226 45 24 13 275 3 mhpC 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q8R431 0.000251 45 22 11 269 1 Mgll Monoglyceride lipase Rattus norvegicus
A1JKU0 0.000357 44 25 9 254 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q9H6B9 0.000671 43 25 2 118 1 EPHX3 Epoxide hydrolase 3 Homo sapiens
Q8R0P8 0.000788 43 23 8 249 2 Abhd8 Protein ABHD8 Mus musculus

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01145
Feature type CDS
Gene -
Product alpha/beta hydrolase
Location 241128 - 241895 (strand: 1)
Length 768 (nucleotides) / 255 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2574
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00561 alpha/beta hydrolase fold

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0596 Coenzyme transport and metabolism (H)
General function prediction only (R)		 HR 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold

Protein Sequence

MFDHKKGALLTQSGNQIYFESTGDETGKAVVFLHGGMQSIASFNPLLNYLPSSELRYIGIDTRGHGRSTLNGTLTYDDIQTDAEAVLKHLNVDECIIIGHSDGGTAALKMALSGVVKVSKVVCIGSQWNMEADDPALEIYDTLTAEAWQAQFPENVAEYEALNPAPDLNHLISELVSLWTDMSEKGYPGNDIDNLSVPLLIIRGDDDFLMSREHAFALAERVASAVLFNLPFAGHTIHEECPAVTGDIITQFLAV

Flanking regions ( +/- flanking 50bp)

CATTAATTTCCCCGGTGCCGGTTCTTTTAAATTATGCGGATGGGTAATTTATGTTTGATCATAAAAAAGGGGCTTTGTTAACCCAAAGCGGTAATCAGATTTATTTTGAAAGTACCGGTGATGAAACAGGAAAAGCGGTTGTTTTCCTGCATGGCGGTATGCAGTCAATCGCTTCATTTAACCCGTTACTGAATTATTTGCCGTCATCAGAATTGCGTTACATCGGAATAGATACACGCGGACACGGGCGCTCCACACTGAACGGCACACTGACTTATGATGATATTCAGACGGATGCAGAAGCGGTTCTGAAACATCTTAATGTGGATGAGTGCATTATTATTGGTCACAGTGACGGCGGAACAGCAGCGCTGAAAATGGCATTGTCCGGCGTGGTGAAGGTCAGCAAAGTTGTCTGTATCGGTTCTCAGTGGAATATGGAAGCGGACGACCCGGCGCTTGAGATTTATGACACGCTTACCGCCGAAGCATGGCAGGCGCAATTTCCTGAGAATGTCGCTGAATATGAAGCACTCAACCCTGCGCCTGATTTAAACCATCTGATCAGTGAATTAGTCTCACTCTGGACGGATATGAGTGAAAAAGGGTATCCGGGCAATGACATTGATAATCTGTCCGTTCCGCTGCTGATTATCCGGGGTGATGACGATTTTCTTATGTCGCGTGAACACGCGTTTGCGCTTGCAGAGCGCGTGGCGTCTGCGGTGTTATTTAATCTGCCGTTTGCCGGTCACACAATACATGAAGAGTGCCCGGCTGTGACCGGTGACATTATTACGCAATTTCTGGCGGTATAACCCTGCTATTGTGTTTTTAACCTGTAATTTATCGCGGTGTCCGCTAAATT